Documentation

Overview

    Package service contains automatically generated AWS clients.

    Source Files

    Directories

    Path Synopsis
    Package accessanalyzer provides the client and types for making API requests to Access Analyzer.
    Package accessanalyzer provides the client and types for making API requests to Access Analyzer.
    accessanalyzeriface
    Package accessanalyzeriface provides an interface to enable mocking the Access Analyzer service client for testing your code.
    Package accessanalyzeriface provides an interface to enable mocking the Access Analyzer service client for testing your code.
    acm
    Package acm provides the client and types for making API requests to ACM.
    Package acm provides the client and types for making API requests to ACM.
    acmiface
    Package acmiface provides an interface to enable mocking the AWS Certificate Manager service client for testing your code.
    Package acmiface provides an interface to enable mocking the AWS Certificate Manager service client for testing your code.
    Package acmpca provides the client and types for making API requests to ACM-PCA.
    Package acmpca provides the client and types for making API requests to ACM-PCA.
    acmpcaiface
    Package acmpcaiface provides an interface to enable mocking the AWS Certificate Manager Private Certificate Authority service client for testing your code.
    Package acmpcaiface provides an interface to enable mocking the AWS Certificate Manager Private Certificate Authority service client for testing your code.
    Package alexaforbusiness provides the client and types for making API requests to Alexa For Business.
    Package alexaforbusiness provides the client and types for making API requests to Alexa For Business.
    alexaforbusinessiface
    Package alexaforbusinessiface provides an interface to enable mocking the Alexa For Business service client for testing your code.
    Package alexaforbusinessiface provides an interface to enable mocking the Alexa For Business service client for testing your code.
    Package amplify provides the client and types for making API requests to Amplify.
    Package amplify provides the client and types for making API requests to Amplify.
    amplifyiface
    Package amplifyiface provides an interface to enable mocking the AWS Amplify service client for testing your code.
    Package amplifyiface provides an interface to enable mocking the AWS Amplify service client for testing your code.
    Package apigateway provides the client and types for making API requests to Amazon API Gateway.
    Package apigateway provides the client and types for making API requests to Amazon API Gateway.
    apigatewayiface
    Package apigatewayiface provides an interface to enable mocking the Amazon API Gateway service client for testing your code.
    Package apigatewayiface provides an interface to enable mocking the Amazon API Gateway service client for testing your code.
    Package apigatewaymanagementapi provides the client and types for making API requests to AmazonApiGatewayManagementApi.
    Package apigatewaymanagementapi provides the client and types for making API requests to AmazonApiGatewayManagementApi.
    apigatewaymanagementapiiface
    Package apigatewaymanagementapiiface provides an interface to enable mocking the AmazonApiGatewayManagementApi service client for testing your code.
    Package apigatewaymanagementapiiface provides an interface to enable mocking the AmazonApiGatewayManagementApi service client for testing your code.
    Package apigatewayv2 provides the client and types for making API requests to AmazonApiGatewayV2.
    Package apigatewayv2 provides the client and types for making API requests to AmazonApiGatewayV2.
    apigatewayv2iface
    Package apigatewayv2iface provides an interface to enable mocking the AmazonApiGatewayV2 service client for testing your code.
    Package apigatewayv2iface provides an interface to enable mocking the AmazonApiGatewayV2 service client for testing your code.
    Package appconfig provides the client and types for making API requests to AppConfig.
    Package appconfig provides the client and types for making API requests to AppConfig.
    appconfigiface
    Package appconfigiface provides an interface to enable mocking the Amazon AppConfig service client for testing your code.
    Package appconfigiface provides an interface to enable mocking the Amazon AppConfig service client for testing your code.
    appflow module
    Package applicationautoscaling provides the client and types for making API requests to Application Auto Scaling.
    Package applicationautoscaling provides the client and types for making API requests to Application Auto Scaling.
    applicationautoscalingiface
    Package applicationautoscalingiface provides an interface to enable mocking the Application Auto Scaling service client for testing your code.
    Package applicationautoscalingiface provides an interface to enable mocking the Application Auto Scaling service client for testing your code.
    Package applicationdiscoveryservice provides the client and types for making API requests to AWS Application Discovery Service.
    Package applicationdiscoveryservice provides the client and types for making API requests to AWS Application Discovery Service.
    applicationdiscoveryserviceiface
    Package applicationdiscoveryserviceiface provides an interface to enable mocking the AWS Application Discovery Service service client for testing your code.
    Package applicationdiscoveryserviceiface provides an interface to enable mocking the AWS Application Discovery Service service client for testing your code.
    Package applicationinsights provides the client and types for making API requests to Application Insights.
    Package applicationinsights provides the client and types for making API requests to Application Insights.
    applicationinsightsiface
    Package applicationinsightsiface provides an interface to enable mocking the Amazon CloudWatch Application Insights service client for testing your code.
    Package applicationinsightsiface provides an interface to enable mocking the Amazon CloudWatch Application Insights service client for testing your code.
    Package appmesh provides the client and types for making API requests to AWS App Mesh.
    Package appmesh provides the client and types for making API requests to AWS App Mesh.
    appmeshiface
    Package appmeshiface provides an interface to enable mocking the AWS App Mesh service client for testing your code.
    Package appmeshiface provides an interface to enable mocking the AWS App Mesh service client for testing your code.
    Package appstream provides the client and types for making API requests to Amazon AppStream.
    Package appstream provides the client and types for making API requests to Amazon AppStream.
    appstreamiface
    Package appstreamiface provides an interface to enable mocking the Amazon AppStream service client for testing your code.
    Package appstreamiface provides an interface to enable mocking the Amazon AppStream service client for testing your code.
    Package appsync provides the client and types for making API requests to AWSAppSync.
    Package appsync provides the client and types for making API requests to AWSAppSync.
    appsynciface
    Package appsynciface provides an interface to enable mocking the AWS AppSync service client for testing your code.
    Package appsynciface provides an interface to enable mocking the AWS AppSync service client for testing your code.
    Package athena provides the client and types for making API requests to Amazon Athena.
    Package athena provides the client and types for making API requests to Amazon Athena.
    athenaiface
    Package athenaiface provides an interface to enable mocking the Amazon Athena service client for testing your code.
    Package athenaiface provides an interface to enable mocking the Amazon Athena service client for testing your code.
    auditmanager module
    Package autoscaling provides the client and types for making API requests to Auto Scaling.
    Package autoscaling provides the client and types for making API requests to Auto Scaling.
    autoscalingiface
    Package autoscalingiface provides an interface to enable mocking the Auto Scaling service client for testing your code.
    Package autoscalingiface provides an interface to enable mocking the Auto Scaling service client for testing your code.
    Package autoscalingplans provides the client and types for making API requests to AWS Auto Scaling Plans.
    Package autoscalingplans provides the client and types for making API requests to AWS Auto Scaling Plans.
    autoscalingplansiface
    Package autoscalingplansiface provides an interface to enable mocking the AWS Auto Scaling Plans service client for testing your code.
    Package autoscalingplansiface provides an interface to enable mocking the AWS Auto Scaling Plans service client for testing your code.
    Package backup provides the client and types for making API requests to AWS Backup.
    Package backup provides the client and types for making API requests to AWS Backup.
    backupiface
    Package backupiface provides an interface to enable mocking the AWS Backup service client for testing your code.
    Package backupiface provides an interface to enable mocking the AWS Backup service client for testing your code.
    Package batch provides the client and types for making API requests to AWS Batch.
    Package batch provides the client and types for making API requests to AWS Batch.
    batchiface
    Package batchiface provides an interface to enable mocking the AWS Batch service client for testing your code.
    Package batchiface provides an interface to enable mocking the AWS Batch service client for testing your code.
    braket module
    Package budgets provides the client and types for making API requests to AWSBudgets.
    Package budgets provides the client and types for making API requests to AWSBudgets.
    budgetsiface
    Package budgetsiface provides an interface to enable mocking the AWS Budgets service client for testing your code.
    Package budgetsiface provides an interface to enable mocking the AWS Budgets service client for testing your code.
    Package chime provides the client and types for making API requests to Amazon Chime.
    Package chime provides the client and types for making API requests to Amazon Chime.
    chimeiface
    Package chimeiface provides an interface to enable mocking the Amazon Chime service client for testing your code.
    Package chimeiface provides an interface to enable mocking the Amazon Chime service client for testing your code.
    Package cloud9 provides the client and types for making API requests to AWS Cloud9.
    Package cloud9 provides the client and types for making API requests to AWS Cloud9.
    cloud9iface
    Package cloud9iface provides an interface to enable mocking the AWS Cloud9 service client for testing your code.
    Package cloud9iface provides an interface to enable mocking the AWS Cloud9 service client for testing your code.
    Package clouddirectory provides the client and types for making API requests to Amazon CloudDirectory.
    Package clouddirectory provides the client and types for making API requests to Amazon CloudDirectory.
    clouddirectoryiface
    Package clouddirectoryiface provides an interface to enable mocking the Amazon CloudDirectory service client for testing your code.
    Package clouddirectoryiface provides an interface to enable mocking the Amazon CloudDirectory service client for testing your code.
    Package cloudformation provides the client and types for making API requests to AWS CloudFormation.
    Package cloudformation provides the client and types for making API requests to AWS CloudFormation.
    cloudformationiface
    Package cloudformationiface provides an interface to enable mocking the AWS CloudFormation service client for testing your code.
    Package cloudformationiface provides an interface to enable mocking the AWS CloudFormation service client for testing your code.
    Package cloudfront provides the client and types for making API requests to CloudFront.
    Package cloudfront provides the client and types for making API requests to CloudFront.
    cloudfrontiface
    Package cloudfrontiface provides an interface to enable mocking the Amazon CloudFront service client for testing your code.
    Package cloudfrontiface provides an interface to enable mocking the Amazon CloudFront service client for testing your code.
    sign
    Package sign provides utilities to generate signed URLs for Amazon CloudFront.
    Package sign provides utilities to generate signed URLs for Amazon CloudFront.
    Package cloudhsm provides the client and types for making API requests to CloudHSM.
    Package cloudhsm provides the client and types for making API requests to CloudHSM.
    cloudhsmiface
    Package cloudhsmiface provides an interface to enable mocking the Amazon CloudHSM service client for testing your code.
    Package cloudhsmiface provides an interface to enable mocking the Amazon CloudHSM service client for testing your code.
    Package cloudhsmv2 provides the client and types for making API requests to CloudHSM V2.
    Package cloudhsmv2 provides the client and types for making API requests to CloudHSM V2.
    cloudhsmv2iface
    Package cloudhsmv2iface provides an interface to enable mocking the AWS CloudHSM V2 service client for testing your code.
    Package cloudhsmv2iface provides an interface to enable mocking the AWS CloudHSM V2 service client for testing your code.
    Package cloudsearch provides the client and types for making API requests to Amazon CloudSearch.
    Package cloudsearch provides the client and types for making API requests to Amazon CloudSearch.
    cloudsearchiface
    Package cloudsearchiface provides an interface to enable mocking the Amazon CloudSearch service client for testing your code.
    Package cloudsearchiface provides an interface to enable mocking the Amazon CloudSearch service client for testing your code.
    Package cloudsearchdomain provides the client and types for making API requests to Amazon CloudSearch Domain.
    Package cloudsearchdomain provides the client and types for making API requests to Amazon CloudSearch Domain.
    cloudsearchdomainiface
    Package cloudsearchdomainiface provides an interface to enable mocking the Amazon CloudSearch Domain service client for testing your code.
    Package cloudsearchdomainiface provides an interface to enable mocking the Amazon CloudSearch Domain service client for testing your code.
    Package cloudtrail provides the client and types for making API requests to CloudTrail.
    Package cloudtrail provides the client and types for making API requests to CloudTrail.
    cloudtrailiface
    Package cloudtrailiface provides an interface to enable mocking the AWS CloudTrail service client for testing your code.
    Package cloudtrailiface provides an interface to enable mocking the AWS CloudTrail service client for testing your code.
    Package cloudwatch provides the client and types for making API requests to CloudWatch.
    Package cloudwatch provides the client and types for making API requests to CloudWatch.
    cloudwatchiface
    Package cloudwatchiface provides an interface to enable mocking the Amazon CloudWatch service client for testing your code.
    Package cloudwatchiface provides an interface to enable mocking the Amazon CloudWatch service client for testing your code.
    Package cloudwatchevents provides the client and types for making API requests to Amazon CloudWatch Events.
    Package cloudwatchevents provides the client and types for making API requests to Amazon CloudWatch Events.
    cloudwatcheventsiface
    Package cloudwatcheventsiface provides an interface to enable mocking the Amazon CloudWatch Events service client for testing your code.
    Package cloudwatcheventsiface provides an interface to enable mocking the Amazon CloudWatch Events service client for testing your code.
    Package cloudwatchlogs provides the client and types for making API requests to Amazon CloudWatch Logs.
    Package cloudwatchlogs provides the client and types for making API requests to Amazon CloudWatch Logs.
    cloudwatchlogsiface
    Package cloudwatchlogsiface provides an interface to enable mocking the Amazon CloudWatch Logs service client for testing your code.
    Package cloudwatchlogsiface provides an interface to enable mocking the Amazon CloudWatch Logs service client for testing your code.
    Package codeartifact provides the client and types for making API requests to CodeArtifact.
    Package codeartifact provides the client and types for making API requests to CodeArtifact.
    codeartifactiface
    Package codeartifactiface provides an interface to enable mocking the CodeArtifact service client for testing your code.
    Package codeartifactiface provides an interface to enable mocking the CodeArtifact service client for testing your code.
    Package codebuild provides the client and types for making API requests to AWS CodeBuild.
    Package codebuild provides the client and types for making API requests to AWS CodeBuild.
    codebuildiface
    Package codebuildiface provides an interface to enable mocking the AWS CodeBuild service client for testing your code.
    Package codebuildiface provides an interface to enable mocking the AWS CodeBuild service client for testing your code.
    Package codecommit provides the client and types for making API requests to CodeCommit.
    Package codecommit provides the client and types for making API requests to CodeCommit.
    codecommitiface
    Package codecommitiface provides an interface to enable mocking the AWS CodeCommit service client for testing your code.
    Package codecommitiface provides an interface to enable mocking the AWS CodeCommit service client for testing your code.
    Package codedeploy provides the client and types for making API requests to CodeDeploy.
    Package codedeploy provides the client and types for making API requests to CodeDeploy.
    codedeployiface
    Package codedeployiface provides an interface to enable mocking the AWS CodeDeploy service client for testing your code.
    Package codedeployiface provides an interface to enable mocking the AWS CodeDeploy service client for testing your code.
    Package codeguruprofiler provides the client and types for making API requests to Amazon CodeGuru Profiler.
    Package codeguruprofiler provides the client and types for making API requests to Amazon CodeGuru Profiler.
    codeguruprofileriface
    Package codeguruprofileriface provides an interface to enable mocking the Amazon CodeGuru Profiler service client for testing your code.
    Package codeguruprofileriface provides an interface to enable mocking the Amazon CodeGuru Profiler service client for testing your code.
    Package codegurureviewer provides the client and types for making API requests to CodeGuruReviewer.
    Package codegurureviewer provides the client and types for making API requests to CodeGuruReviewer.
    codegururevieweriface
    Package codegururevieweriface provides an interface to enable mocking the Amazon CodeGuru Reviewer service client for testing your code.
    Package codegururevieweriface provides an interface to enable mocking the Amazon CodeGuru Reviewer service client for testing your code.
    Package codepipeline provides the client and types for making API requests to CodePipeline.
    Package codepipeline provides the client and types for making API requests to CodePipeline.
    codepipelineiface
    Package codepipelineiface provides an interface to enable mocking the AWS CodePipeline service client for testing your code.
    Package codepipelineiface provides an interface to enable mocking the AWS CodePipeline service client for testing your code.
    Package codestar provides the client and types for making API requests to CodeStar.
    Package codestar provides the client and types for making API requests to CodeStar.
    codestariface
    Package codestariface provides an interface to enable mocking the AWS CodeStar service client for testing your code.
    Package codestariface provides an interface to enable mocking the AWS CodeStar service client for testing your code.
    Package codestarconnections provides the client and types for making API requests to AWS CodeStar connections.
    Package codestarconnections provides the client and types for making API requests to AWS CodeStar connections.
    codestarconnectionsiface
    Package codestarconnectionsiface provides an interface to enable mocking the AWS CodeStar connections service client for testing your code.
    Package codestarconnectionsiface provides an interface to enable mocking the AWS CodeStar connections service client for testing your code.
    Package codestarnotifications provides the client and types for making API requests to AWS CodeStar Notifications.
    Package codestarnotifications provides the client and types for making API requests to AWS CodeStar Notifications.
    codestarnotificationsiface
    Package codestarnotificationsiface provides an interface to enable mocking the AWS CodeStar Notifications service client for testing your code.
    Package codestarnotificationsiface provides an interface to enable mocking the AWS CodeStar Notifications service client for testing your code.
    Package cognitoidentity provides the client and types for making API requests to Amazon Cognito Identity.
    Package cognitoidentity provides the client and types for making API requests to Amazon Cognito Identity.
    cognitoidentityiface
    Package cognitoidentityiface provides an interface to enable mocking the Amazon Cognito Identity service client for testing your code.
    Package cognitoidentityiface provides an interface to enable mocking the Amazon Cognito Identity service client for testing your code.
    Package cognitoidentityprovider provides the client and types for making API requests to Amazon Cognito Identity Provider.
    Package cognitoidentityprovider provides the client and types for making API requests to Amazon Cognito Identity Provider.
    cognitoidentityprovideriface
    Package cognitoidentityprovideriface provides an interface to enable mocking the Amazon Cognito Identity Provider service client for testing your code.
    Package cognitoidentityprovideriface provides an interface to enable mocking the Amazon Cognito Identity Provider service client for testing your code.
    Package cognitosync provides the client and types for making API requests to Amazon Cognito Sync.
    Package cognitosync provides the client and types for making API requests to Amazon Cognito Sync.
    cognitosynciface
    Package cognitosynciface provides an interface to enable mocking the Amazon Cognito Sync service client for testing your code.
    Package cognitosynciface provides an interface to enable mocking the Amazon Cognito Sync service client for testing your code.
    Package comprehend provides the client and types for making API requests to Amazon Comprehend.
    Package comprehend provides the client and types for making API requests to Amazon Comprehend.
    comprehendiface
    Package comprehendiface provides an interface to enable mocking the Amazon Comprehend service client for testing your code.
    Package comprehendiface provides an interface to enable mocking the Amazon Comprehend service client for testing your code.
    Package comprehendmedical provides the client and types for making API requests to ComprehendMedical.
    Package comprehendmedical provides the client and types for making API requests to ComprehendMedical.
    comprehendmedicaliface
    Package comprehendmedicaliface provides an interface to enable mocking the AWS Comprehend Medical service client for testing your code.
    Package comprehendmedicaliface provides an interface to enable mocking the AWS Comprehend Medical service client for testing your code.
    Package computeoptimizer provides the client and types for making API requests to AWS Compute Optimizer.
    Package computeoptimizer provides the client and types for making API requests to AWS Compute Optimizer.
    computeoptimizeriface
    Package computeoptimizeriface provides an interface to enable mocking the AWS Compute Optimizer service client for testing your code.
    Package computeoptimizeriface provides an interface to enable mocking the AWS Compute Optimizer service client for testing your code.
    Package configservice provides the client and types for making API requests to Config Service.
    Package configservice provides the client and types for making API requests to Config Service.
    configserviceiface
    Package configserviceiface provides an interface to enable mocking the AWS Config service client for testing your code.
    Package configserviceiface provides an interface to enable mocking the AWS Config service client for testing your code.
    Package connect provides the client and types for making API requests to Amazon Connect.
    Package connect provides the client and types for making API requests to Amazon Connect.
    connectiface
    Package connectiface provides an interface to enable mocking the Amazon Connect Service service client for testing your code.
    Package connectiface provides an interface to enable mocking the Amazon Connect Service service client for testing your code.
    Package connectparticipant provides the client and types for making API requests to Amazon Connect Participant.
    Package connectparticipant provides the client and types for making API requests to Amazon Connect Participant.
    connectparticipantiface
    Package connectparticipantiface provides an interface to enable mocking the Amazon Connect Participant Service service client for testing your code.
    Package connectparticipantiface provides an interface to enable mocking the Amazon Connect Participant Service service client for testing your code.
    Package costandusagereportservice provides the client and types for making API requests to AWS Cost and Usage Report Service.
    Package costandusagereportservice provides the client and types for making API requests to AWS Cost and Usage Report Service.
    costandusagereportserviceiface
    Package costandusagereportserviceiface provides an interface to enable mocking the AWS Cost and Usage Report Service service client for testing your code.
    Package costandusagereportserviceiface provides an interface to enable mocking the AWS Cost and Usage Report Service service client for testing your code.
    Package costexplorer provides the client and types for making API requests to AWS Cost Explorer.
    Package costexplorer provides the client and types for making API requests to AWS Cost Explorer.
    costexploreriface
    Package costexploreriface provides an interface to enable mocking the AWS Cost Explorer Service service client for testing your code.
    Package costexploreriface provides an interface to enable mocking the AWS Cost Explorer Service service client for testing your code.
    Package databasemigrationservice provides the client and types for making API requests to AWS Database Migration Service.
    Package databasemigrationservice provides the client and types for making API requests to AWS Database Migration Service.
    databasemigrationserviceiface
    Package databasemigrationserviceiface provides an interface to enable mocking the AWS Database Migration Service service client for testing your code.
    Package databasemigrationserviceiface provides an interface to enable mocking the AWS Database Migration Service service client for testing your code.
    databrew module
    Package dataexchange provides the client and types for making API requests to AWS Data Exchange.
    Package dataexchange provides the client and types for making API requests to AWS Data Exchange.
    dataexchangeiface
    Package dataexchangeiface provides an interface to enable mocking the AWS Data Exchange service client for testing your code.
    Package dataexchangeiface provides an interface to enable mocking the AWS Data Exchange service client for testing your code.
    Package datapipeline provides the client and types for making API requests to AWS Data Pipeline.
    Package datapipeline provides the client and types for making API requests to AWS Data Pipeline.
    datapipelineiface
    Package datapipelineiface provides an interface to enable mocking the AWS Data Pipeline service client for testing your code.
    Package datapipelineiface provides an interface to enable mocking the AWS Data Pipeline service client for testing your code.
    Package datasync provides the client and types for making API requests to DataSync.
    Package datasync provides the client and types for making API requests to DataSync.
    datasynciface
    Package datasynciface provides an interface to enable mocking the AWS DataSync service client for testing your code.
    Package datasynciface provides an interface to enable mocking the AWS DataSync service client for testing your code.
    dax
    Package dax provides the client and types for making API requests to Amazon DAX.
    Package dax provides the client and types for making API requests to Amazon DAX.
    daxiface
    Package daxiface provides an interface to enable mocking the Amazon DynamoDB Accelerator (DAX) service client for testing your code.
    Package daxiface provides an interface to enable mocking the Amazon DynamoDB Accelerator (DAX) service client for testing your code.
    Package detective provides the client and types for making API requests to Amazon Detective.
    Package detective provides the client and types for making API requests to Amazon Detective.
    detectiveiface
    Package detectiveiface provides an interface to enable mocking the Amazon Detective service client for testing your code.
    Package detectiveiface provides an interface to enable mocking the Amazon Detective service client for testing your code.
    Package devicefarm provides the client and types for making API requests to AWS Device Farm.
    Package devicefarm provides the client and types for making API requests to AWS Device Farm.
    devicefarmiface
    Package devicefarmiface provides an interface to enable mocking the AWS Device Farm service client for testing your code.
    Package devicefarmiface provides an interface to enable mocking the AWS Device Farm service client for testing your code.
    devopsguru module
    Package directconnect provides the client and types for making API requests to AWS Direct Connect.
    Package directconnect provides the client and types for making API requests to AWS Direct Connect.
    directconnectiface
    Package directconnectiface provides an interface to enable mocking the AWS Direct Connect service client for testing your code.
    Package directconnectiface provides an interface to enable mocking the AWS Direct Connect service client for testing your code.
    Package directoryservice provides the client and types for making API requests to Directory Service.
    Package directoryservice provides the client and types for making API requests to Directory Service.
    directoryserviceiface
    Package directoryserviceiface provides an interface to enable mocking the AWS Directory Service service client for testing your code.
    Package directoryserviceiface provides an interface to enable mocking the AWS Directory Service service client for testing your code.
    dlm
    Package dlm provides the client and types for making API requests to Amazon DLM.
    Package dlm provides the client and types for making API requests to Amazon DLM.
    dlmiface
    Package dlmiface provides an interface to enable mocking the Amazon Data Lifecycle Manager service client for testing your code.
    Package dlmiface provides an interface to enable mocking the Amazon Data Lifecycle Manager service client for testing your code.
    Package docdb provides the client and types for making API requests to Amazon DocDB.
    Package docdb provides the client and types for making API requests to Amazon DocDB.
    docdbiface
    Package docdbiface provides an interface to enable mocking the Amazon DocumentDB with MongoDB compatibility service client for testing your code.
    Package docdbiface provides an interface to enable mocking the Amazon DocumentDB with MongoDB compatibility service client for testing your code.
    Package dynamodb provides the client and types for making API requests to DynamoDB.
    Package dynamodb provides the client and types for making API requests to DynamoDB.
    dynamodbattribute
    Package dynamodbattribute provides marshaling and unmarshaling utilities to convert between Go types and dynamodb.AttributeValues.
    Package dynamodbattribute provides marshaling and unmarshaling utilities to convert between Go types and dynamodb.AttributeValues.
    dynamodbiface
    Package dynamodbiface provides an interface to enable mocking the Amazon DynamoDB service client for testing your code.
    Package dynamodbiface provides an interface to enable mocking the Amazon DynamoDB service client for testing your code.
    expression
    Package expression provides types and functions to create Amazon DynamoDB Expression strings, ExpressionAttributeNames maps, and ExpressionAttributeValues maps.
    Package expression provides types and functions to create Amazon DynamoDB Expression strings, ExpressionAttributeNames maps, and ExpressionAttributeValues maps.
    Package dynamodbstreams provides the client and types for making API requests to Amazon DynamoDB Streams.
    Package dynamodbstreams provides the client and types for making API requests to Amazon DynamoDB Streams.
    dynamodbstreamsiface
    Package dynamodbstreamsiface provides an interface to enable mocking the Amazon DynamoDB Streams service client for testing your code.
    Package dynamodbstreamsiface provides an interface to enable mocking the Amazon DynamoDB Streams service client for testing your code.
    ebs
    Package ebs provides the client and types for making API requests to Amazon EBS.
    Package ebs provides the client and types for making API requests to Amazon EBS.
    ebsiface
    Package ebsiface provides an interface to enable mocking the Amazon Elastic Block Store service client for testing your code.
    Package ebsiface provides an interface to enable mocking the Amazon Elastic Block Store service client for testing your code.
    ec2
    Package ec2 provides the client and types for making API requests to Amazon EC2.
    Package ec2 provides the client and types for making API requests to Amazon EC2.
    ec2iface
    Package ec2iface provides an interface to enable mocking the Amazon Elastic Compute Cloud service client for testing your code.
    Package ec2iface provides an interface to enable mocking the Amazon Elastic Compute Cloud service client for testing your code.
    Package ec2instanceconnect provides the client and types for making API requests to EC2 Instance Connect.
    Package ec2instanceconnect provides the client and types for making API requests to EC2 Instance Connect.
    ec2instanceconnectiface
    Package ec2instanceconnectiface provides an interface to enable mocking the AWS EC2 Instance Connect service client for testing your code.
    Package ec2instanceconnectiface provides an interface to enable mocking the AWS EC2 Instance Connect service client for testing your code.
    ecr
    Package ecr provides the client and types for making API requests to Amazon ECR.
    Package ecr provides the client and types for making API requests to Amazon ECR.
    ecriface
    Package ecriface provides an interface to enable mocking the Amazon EC2 Container Registry service client for testing your code.
    Package ecriface provides an interface to enable mocking the Amazon EC2 Container Registry service client for testing your code.
    ecrpublic module
    ecs
    Package ecs provides the client and types for making API requests to Amazon ECS.
    Package ecs provides the client and types for making API requests to Amazon ECS.
    ecsiface
    Package ecsiface provides an interface to enable mocking the Amazon EC2 Container Service service client for testing your code.
    Package ecsiface provides an interface to enable mocking the Amazon EC2 Container Service service client for testing your code.
    efs
    Package efs provides the client and types for making API requests to EFS.
    Package efs provides the client and types for making API requests to EFS.
    efsiface
    Package efsiface provides an interface to enable mocking the Amazon Elastic File System service client for testing your code.
    Package efsiface provides an interface to enable mocking the Amazon Elastic File System service client for testing your code.
    eks
    Package eks provides the client and types for making API requests to Amazon EKS.
    Package eks provides the client and types for making API requests to Amazon EKS.
    eksiface
    Package eksiface provides an interface to enable mocking the Amazon Elastic Kubernetes Service service client for testing your code.
    Package eksiface provides an interface to enable mocking the Amazon Elastic Kubernetes Service service client for testing your code.
    Package elasticache provides the client and types for making API requests to Amazon ElastiCache.
    Package elasticache provides the client and types for making API requests to Amazon ElastiCache.
    elasticacheiface
    Package elasticacheiface provides an interface to enable mocking the Amazon ElastiCache service client for testing your code.
    Package elasticacheiface provides an interface to enable mocking the Amazon ElastiCache service client for testing your code.
    Package elasticbeanstalk provides the client and types for making API requests to Elastic Beanstalk.
    Package elasticbeanstalk provides the client and types for making API requests to Elastic Beanstalk.
    elasticbeanstalkiface
    Package elasticbeanstalkiface provides an interface to enable mocking the AWS Elastic Beanstalk service client for testing your code.
    Package elasticbeanstalkiface provides an interface to enable mocking the AWS Elastic Beanstalk service client for testing your code.
    Package elasticinference provides the client and types for making API requests to Amazon Elastic Inference.
    Package elasticinference provides the client and types for making API requests to Amazon Elastic Inference.
    elasticinferenceiface
    Package elasticinferenceiface provides an interface to enable mocking the Amazon Elastic Inference service client for testing your code.
    Package elasticinferenceiface provides an interface to enable mocking the Amazon Elastic Inference service client for testing your code.
    Package elasticloadbalancing provides the client and types for making API requests to Elastic Load Balancing.
    Package elasticloadbalancing provides the client and types for making API requests to Elastic Load Balancing.
    elasticloadbalancingiface
    Package elasticloadbalancingiface provides an interface to enable mocking the Elastic Load Balancing service client for testing your code.
    Package elasticloadbalancingiface provides an interface to enable mocking the Elastic Load Balancing service client for testing your code.
    Package elasticloadbalancingv2 provides the client and types for making API requests to Elastic Load Balancing v2.
    Package elasticloadbalancingv2 provides the client and types for making API requests to Elastic Load Balancing v2.
    elasticloadbalancingv2iface
    Package elasticloadbalancingv2iface provides an interface to enable mocking the Elastic Load Balancing service client for testing your code.
    Package elasticloadbalancingv2iface provides an interface to enable mocking the Elastic Load Balancing service client for testing your code.
    Package elasticsearchservice provides the client and types for making API requests to Amazon Elasticsearch Service.
    Package elasticsearchservice provides the client and types for making API requests to Amazon Elasticsearch Service.
    elasticsearchserviceiface
    Package elasticsearchserviceiface provides an interface to enable mocking the Amazon Elasticsearch Service service client for testing your code.
    Package elasticsearchserviceiface provides an interface to enable mocking the Amazon Elasticsearch Service service client for testing your code.
    Package elastictranscoder provides the client and types for making API requests to Amazon Elastic Transcoder.
    Package elastictranscoder provides the client and types for making API requests to Amazon Elastic Transcoder.
    elastictranscoderiface
    Package elastictranscoderiface provides an interface to enable mocking the Amazon Elastic Transcoder service client for testing your code.
    Package elastictranscoderiface provides an interface to enable mocking the Amazon Elastic Transcoder service client for testing your code.
    emr
    Package emr provides the client and types for making API requests to Amazon EMR.
    Package emr provides the client and types for making API requests to Amazon EMR.
    emriface
    Package emriface provides an interface to enable mocking the Amazon Elastic MapReduce service client for testing your code.
    Package emriface provides an interface to enable mocking the Amazon Elastic MapReduce service client for testing your code.
    Package eventbridge provides the client and types for making API requests to Amazon EventBridge.
    Package eventbridge provides the client and types for making API requests to Amazon EventBridge.
    eventbridgeiface
    Package eventbridgeiface provides an interface to enable mocking the Amazon EventBridge service client for testing your code.
    Package eventbridgeiface provides an interface to enable mocking the Amazon EventBridge service client for testing your code.
    Package firehose provides the client and types for making API requests to Firehose.
    Package firehose provides the client and types for making API requests to Firehose.
    firehoseiface
    Package firehoseiface provides an interface to enable mocking the Amazon Kinesis Firehose service client for testing your code.
    Package firehoseiface provides an interface to enable mocking the Amazon Kinesis Firehose service client for testing your code.
    fis module
    fms
    Package fms provides the client and types for making API requests to FMS.
    Package fms provides the client and types for making API requests to FMS.
    fmsiface
    Package fmsiface provides an interface to enable mocking the Firewall Management Service service client for testing your code.
    Package fmsiface provides an interface to enable mocking the Firewall Management Service service client for testing your code.
    Package forecast provides the client and types for making API requests to Amazon Forecast Service.
    Package forecast provides the client and types for making API requests to Amazon Forecast Service.
    forecastiface
    Package forecastiface provides an interface to enable mocking the Amazon Forecast Service service client for testing your code.
    Package forecastiface provides an interface to enable mocking the Amazon Forecast Service service client for testing your code.
    Package forecastquery provides the client and types for making API requests to Amazon Forecast Query Service.
    Package forecastquery provides the client and types for making API requests to Amazon Forecast Query Service.
    forecastqueryiface
    Package forecastqueryiface provides an interface to enable mocking the Amazon Forecast Query Service service client for testing your code.
    Package forecastqueryiface provides an interface to enable mocking the Amazon Forecast Query Service service client for testing your code.
    Package frauddetector provides the client and types for making API requests to Amazon Fraud Detector.
    Package frauddetector provides the client and types for making API requests to Amazon Fraud Detector.
    frauddetectoriface
    Package frauddetectoriface provides an interface to enable mocking the Amazon Fraud Detector service client for testing your code.
    Package frauddetectoriface provides an interface to enable mocking the Amazon Fraud Detector service client for testing your code.
    fsx
    Package fsx provides the client and types for making API requests to Amazon FSx.
    Package fsx provides the client and types for making API requests to Amazon FSx.
    fsxiface
    Package fsxiface provides an interface to enable mocking the Amazon FSx service client for testing your code.
    Package fsxiface provides an interface to enable mocking the Amazon FSx service client for testing your code.
    Package gamelift provides the client and types for making API requests to Amazon GameLift.
    Package gamelift provides the client and types for making API requests to Amazon GameLift.
    gameliftiface
    Package gameliftiface provides an interface to enable mocking the Amazon GameLift service client for testing your code.
    Package gameliftiface provides an interface to enable mocking the Amazon GameLift service client for testing your code.
    Package glacier provides the client and types for making API requests to Amazon Glacier.
    Package glacier provides the client and types for making API requests to Amazon Glacier.
    glacieriface
    Package glacieriface provides an interface to enable mocking the Amazon Glacier service client for testing your code.
    Package glacieriface provides an interface to enable mocking the Amazon Glacier service client for testing your code.
    Package globalaccelerator provides the client and types for making API requests to AWS Global Accelerator.
    Package globalaccelerator provides the client and types for making API requests to AWS Global Accelerator.
    globalacceleratoriface
    Package globalacceleratoriface provides an interface to enable mocking the AWS Global Accelerator service client for testing your code.
    Package globalacceleratoriface provides an interface to enable mocking the AWS Global Accelerator service client for testing your code.
    Package glue provides the client and types for making API requests to AWS Glue.
    Package glue provides the client and types for making API requests to AWS Glue.
    glueiface
    Package glueiface provides an interface to enable mocking the AWS Glue service client for testing your code.
    Package glueiface provides an interface to enable mocking the AWS Glue service client for testing your code.
    Package greengrass provides the client and types for making API requests to AWS Greengrass.
    Package greengrass provides the client and types for making API requests to AWS Greengrass.
    greengrassiface
    Package greengrassiface provides an interface to enable mocking the AWS Greengrass service client for testing your code.
    Package greengrassiface provides an interface to enable mocking the AWS Greengrass service client for testing your code.
    greengrassv2 module
    Package groundstation provides the client and types for making API requests to AWS Ground Station.
    Package groundstation provides the client and types for making API requests to AWS Ground Station.
    groundstationiface
    Package groundstationiface provides an interface to enable mocking the AWS Ground Station service client for testing your code.
    Package groundstationiface provides an interface to enable mocking the AWS Ground Station service client for testing your code.
    Package guardduty provides the client and types for making API requests to Amazon GuardDuty.
    Package guardduty provides the client and types for making API requests to Amazon GuardDuty.
    guarddutyiface
    Package guarddutyiface provides an interface to enable mocking the Amazon GuardDuty service client for testing your code.
    Package guarddutyiface provides an interface to enable mocking the Amazon GuardDuty service client for testing your code.
    Package health provides the client and types for making API requests to AWSHealth.
    Package health provides the client and types for making API requests to AWSHealth.
    healthiface
    Package healthiface provides an interface to enable mocking the AWS Health APIs and Notifications service client for testing your code.
    Package healthiface provides an interface to enable mocking the AWS Health APIs and Notifications service client for testing your code.
    healthlake module
    Package honeycode provides the client and types for making API requests to Honeycode.
    Package honeycode provides the client and types for making API requests to Honeycode.
    honeycodeiface
    Package honeycodeiface provides an interface to enable mocking the Amazon Honeycode service client for testing your code.
    Package honeycodeiface provides an interface to enable mocking the Amazon Honeycode service client for testing your code.
    iam
    Package iam provides the client and types for making API requests to IAM.
    Package iam provides the client and types for making API requests to IAM.
    iamiface
    Package iamiface provides an interface to enable mocking the AWS Identity and Access Management service client for testing your code.
    Package iamiface provides an interface to enable mocking the AWS Identity and Access Management service client for testing your code.
    Package imagebuilder provides the client and types for making API requests to imagebuilder.
    Package imagebuilder provides the client and types for making API requests to imagebuilder.
    imagebuilderiface
    Package imagebuilderiface provides an interface to enable mocking the EC2 Image Builder service client for testing your code.
    Package imagebuilderiface provides an interface to enable mocking the EC2 Image Builder service client for testing your code.
    Package inspector provides the client and types for making API requests to Amazon Inspector.
    Package inspector provides the client and types for making API requests to Amazon Inspector.
    inspectoriface
    Package inspectoriface provides an interface to enable mocking the Amazon Inspector service client for testing your code.
    Package inspectoriface provides an interface to enable mocking the Amazon Inspector service client for testing your code.
    iot
    Package iot provides the client and types for making API requests to AWS IoT. AWS IoT provides secure, bi-directional communication between Internet-connected devices (such as sensors, actuators, embedded devices, or smart appliances) and the AWS cloud.
    Package iot provides the client and types for making API requests to AWS IoT. AWS IoT provides secure, bi-directional communication between Internet-connected devices (such as sensors, actuators, embedded devices, or smart appliances) and the AWS cloud.
    iotiface
    Package iotiface provides an interface to enable mocking the AWS IoT service client for testing your code.
    Package iotiface provides an interface to enable mocking the AWS IoT service client for testing your code.
    Package iot1clickdevicesservice provides the client and types for making API requests to AWS IoT 1-Click Devices Service.
    Package iot1clickdevicesservice provides the client and types for making API requests to AWS IoT 1-Click Devices Service.
    iot1clickdevicesserviceiface
    Package iot1clickdevicesserviceiface provides an interface to enable mocking the AWS IoT 1-Click Devices Service service client for testing your code.
    Package iot1clickdevicesserviceiface provides an interface to enable mocking the AWS IoT 1-Click Devices Service service client for testing your code.
    Package iot1clickprojects provides the client and types for making API requests to AWS IoT 1-Click Projects.
    Package iot1clickprojects provides the client and types for making API requests to AWS IoT 1-Click Projects.
    iot1clickprojectsiface
    Package iot1clickprojectsiface provides an interface to enable mocking the AWS IoT 1-Click Projects Service service client for testing your code.
    Package iot1clickprojectsiface provides an interface to enable mocking the AWS IoT 1-Click Projects Service service client for testing your code.
    Package iotanalytics provides the client and types for making API requests to AWS IoT Analytics.
    Package iotanalytics provides the client and types for making API requests to AWS IoT Analytics.
    iotanalyticsiface
    Package iotanalyticsiface provides an interface to enable mocking the AWS IoT Analytics service client for testing your code.
    Package iotanalyticsiface provides an interface to enable mocking the AWS IoT Analytics service client for testing your code.
    Package iotdataplane provides the client and types for making API requests to AWS IoT Data Plane.
    Package iotdataplane provides the client and types for making API requests to AWS IoT Data Plane.
    iotdataplaneiface
    Package iotdataplaneiface provides an interface to enable mocking the AWS IoT Data Plane service client for testing your code.
    Package iotdataplaneiface provides an interface to enable mocking the AWS IoT Data Plane service client for testing your code.
    Package iotevents provides the client and types for making API requests to AWS IoT Events.
    Package iotevents provides the client and types for making API requests to AWS IoT Events.
    ioteventsiface
    Package ioteventsiface provides an interface to enable mocking the AWS IoT Events service client for testing your code.
    Package ioteventsiface provides an interface to enable mocking the AWS IoT Events service client for testing your code.
    Package ioteventsdata provides the client and types for making API requests to AWS IoT Events Data.
    Package ioteventsdata provides the client and types for making API requests to AWS IoT Events Data.
    ioteventsdataiface
    Package ioteventsdataiface provides an interface to enable mocking the AWS IoT Events Data service client for testing your code.
    Package ioteventsdataiface provides an interface to enable mocking the AWS IoT Events Data service client for testing your code.
    iotfleethub module
    Package iotjobsdataplane provides the client and types for making API requests to AWS IoT Jobs Data Plane.
    Package iotjobsdataplane provides the client and types for making API requests to AWS IoT Jobs Data Plane.
    iotjobsdataplaneiface
    Package iotjobsdataplaneiface provides an interface to enable mocking the AWS IoT Jobs Data Plane service client for testing your code.
    Package iotjobsdataplaneiface provides an interface to enable mocking the AWS IoT Jobs Data Plane service client for testing your code.
    Package iotsecuretunneling provides the client and types for making API requests to AWS IoT Secure Tunneling.
    Package iotsecuretunneling provides the client and types for making API requests to AWS IoT Secure Tunneling.
    iotsecuretunnelingiface
    Package iotsecuretunnelingiface provides an interface to enable mocking the AWS IoT Secure Tunneling service client for testing your code.
    Package iotsecuretunnelingiface provides an interface to enable mocking the AWS IoT Secure Tunneling service client for testing your code.
    Package iotsitewise provides the client and types for making API requests to AWS IoT SiteWise.
    Package iotsitewise provides the client and types for making API requests to AWS IoT SiteWise.
    iotsitewiseiface
    Package iotsitewiseiface provides an interface to enable mocking the AWS IoT SiteWise service client for testing your code.
    Package iotsitewiseiface provides an interface to enable mocking the AWS IoT SiteWise service client for testing your code.
    Package iotthingsgraph provides the client and types for making API requests to AWS IoT Things Graph.
    Package iotthingsgraph provides the client and types for making API requests to AWS IoT Things Graph.
    iotthingsgraphiface
    Package iotthingsgraphiface provides an interface to enable mocking the AWS IoT Things Graph service client for testing your code.
    Package iotthingsgraphiface provides an interface to enable mocking the AWS IoT Things Graph service client for testing your code.
    iotwireless module
    ivs
    Package ivs provides the client and types for making API requests to Amazon IVS.
    Package ivs provides the client and types for making API requests to Amazon IVS.
    ivsiface
    Package ivsiface provides an interface to enable mocking the Amazon Interactive Video Service service client for testing your code.
    Package ivsiface provides an interface to enable mocking the Amazon Interactive Video Service service client for testing your code.
    Package kafka provides the client and types for making API requests to Kafka.
    Package kafka provides the client and types for making API requests to Kafka.
    kafkaiface
    Package kafkaiface provides an interface to enable mocking the Managed Streaming for Kafka service client for testing your code.
    Package kafkaiface provides an interface to enable mocking the Managed Streaming for Kafka service client for testing your code.
    Package kendra provides the client and types for making API requests to kendra.
    Package kendra provides the client and types for making API requests to kendra.
    kendraiface
    Package kendraiface provides an interface to enable mocking the AWSKendraFrontendService service client for testing your code.
    Package kendraiface provides an interface to enable mocking the AWSKendraFrontendService service client for testing your code.
    Package kinesis provides the client and types for making API requests to Kinesis.
    Package kinesis provides the client and types for making API requests to Kinesis.
    kinesisiface
    Package kinesisiface provides an interface to enable mocking the Amazon Kinesis service client for testing your code.
    Package kinesisiface provides an interface to enable mocking the Amazon Kinesis service client for testing your code.
    Package kinesisanalytics provides the client and types for making API requests to Kinesis Analytics.
    Package kinesisanalytics provides the client and types for making API requests to Kinesis Analytics.
    kinesisanalyticsiface
    Package kinesisanalyticsiface provides an interface to enable mocking the Amazon Kinesis Analytics service client for testing your code.
    Package kinesisanalyticsiface provides an interface to enable mocking the Amazon Kinesis Analytics service client for testing your code.
    Package kinesisanalyticsv2 provides the client and types for making API requests to Kinesis Analytics V2.
    Package kinesisanalyticsv2 provides the client and types for making API requests to Kinesis Analytics V2.
    kinesisanalyticsv2iface
    Package kinesisanalyticsv2iface provides an interface to enable mocking the Amazon Kinesis Analytics service client for testing your code.
    Package kinesisanalyticsv2iface provides an interface to enable mocking the Amazon Kinesis Analytics service client for testing your code.
    Package kinesisvideo provides the client and types for making API requests to Kinesis Video.
    Package kinesisvideo provides the client and types for making API requests to Kinesis Video.
    kinesisvideoiface
    Package kinesisvideoiface provides an interface to enable mocking the Amazon Kinesis Video Streams service client for testing your code.
    Package kinesisvideoiface provides an interface to enable mocking the Amazon Kinesis Video Streams service client for testing your code.
    Package kinesisvideoarchivedmedia provides the client and types for making API requests to Kinesis Video Archived Media.
    Package kinesisvideoarchivedmedia provides the client and types for making API requests to Kinesis Video Archived Media.
    kinesisvideoarchivedmediaiface
    Package kinesisvideoarchivedmediaiface provides an interface to enable mocking the Amazon Kinesis Video Streams Archived Media service client for testing your code.
    Package kinesisvideoarchivedmediaiface provides an interface to enable mocking the Amazon Kinesis Video Streams Archived Media service client for testing your code.
    Package kinesisvideomedia provides the client and types for making API requests to Kinesis Video Media.
    Package kinesisvideomedia provides the client and types for making API requests to Kinesis Video Media.
    kinesisvideomediaiface
    Package kinesisvideomediaiface provides an interface to enable mocking the Amazon Kinesis Video Streams Media service client for testing your code.
    Package kinesisvideomediaiface provides an interface to enable mocking the Amazon Kinesis Video Streams Media service client for testing your code.
    Package kinesisvideosignaling provides the client and types for making API requests to Amazon Kinesis Video Signaling Channels.
    Package kinesisvideosignaling provides the client and types for making API requests to Amazon Kinesis Video Signaling Channels.
    kinesisvideosignalingiface
    Package kinesisvideosignalingiface provides an interface to enable mocking the Amazon Kinesis Video Signaling Channels service client for testing your code.
    Package kinesisvideosignalingiface provides an interface to enable mocking the Amazon Kinesis Video Signaling Channels service client for testing your code.
    kms
    Package kms provides the client and types for making API requests to KMS.
    Package kms provides the client and types for making API requests to KMS.
    kmsiface
    Package kmsiface provides an interface to enable mocking the AWS Key Management Service service client for testing your code.
    Package kmsiface provides an interface to enable mocking the AWS Key Management Service service client for testing your code.
    Package lakeformation provides the client and types for making API requests to AWS Lake Formation.
    Package lakeformation provides the client and types for making API requests to AWS Lake Formation.
    lakeformationiface
    Package lakeformationiface provides an interface to enable mocking the AWS Lake Formation service client for testing your code.
    Package lakeformationiface provides an interface to enable mocking the AWS Lake Formation service client for testing your code.
    Package lambda provides the client and types for making API requests to AWS Lambda.
    Package lambda provides the client and types for making API requests to AWS Lambda.
    lambdaiface
    Package lambdaiface provides an interface to enable mocking the AWS Lambda service client for testing your code.
    Package lambdaiface provides an interface to enable mocking the AWS Lambda service client for testing your code.
    Package lexmodelbuildingservice provides the client and types for making API requests to Amazon Lex Model Building Service.
    Package lexmodelbuildingservice provides the client and types for making API requests to Amazon Lex Model Building Service.
    lexmodelbuildingserviceiface
    Package lexmodelbuildingserviceiface provides an interface to enable mocking the Amazon Lex Model Building Service service client for testing your code.
    Package lexmodelbuildingserviceiface provides an interface to enable mocking the Amazon Lex Model Building Service service client for testing your code.
    Package lexruntimeservice provides the client and types for making API requests to Amazon Lex Runtime Service.
    Package lexruntimeservice provides the client and types for making API requests to Amazon Lex Runtime Service.
    lexruntimeserviceiface
    Package lexruntimeserviceiface provides an interface to enable mocking the Amazon Lex Runtime Service service client for testing your code.
    Package lexruntimeserviceiface provides an interface to enable mocking the Amazon Lex Runtime Service service client for testing your code.
    lexruntimev2 module
    Package licensemanager provides the client and types for making API requests to AWS License Manager.
    Package licensemanager provides the client and types for making API requests to AWS License Manager.
    licensemanageriface
    Package licensemanageriface provides an interface to enable mocking the AWS License Manager service client for testing your code.
    Package licensemanageriface provides an interface to enable mocking the AWS License Manager service client for testing your code.
    Package lightsail provides the client and types for making API requests to Amazon Lightsail.
    Package lightsail provides the client and types for making API requests to Amazon Lightsail.
    lightsailiface
    Package lightsailiface provides an interface to enable mocking the Amazon Lightsail service client for testing your code.
    Package lightsailiface provides an interface to enable mocking the Amazon Lightsail service client for testing your code.
    Package machinelearning provides the client and types for making API requests to Amazon Machine Learning.
    Package machinelearning provides the client and types for making API requests to Amazon Machine Learning.
    machinelearningiface
    Package machinelearningiface provides an interface to enable mocking the Amazon Machine Learning service client for testing your code.
    Package machinelearningiface provides an interface to enable mocking the Amazon Machine Learning service client for testing your code.
    Package macie provides the client and types for making API requests to Amazon Macie.
    Package macie provides the client and types for making API requests to Amazon Macie.
    macieiface
    Package macieiface provides an interface to enable mocking the Amazon Macie service client for testing your code.
    Package macieiface provides an interface to enable mocking the Amazon Macie service client for testing your code.
    Package macie2 provides the client and types for making API requests to Amazon Macie 2.
    Package macie2 provides the client and types for making API requests to Amazon Macie 2.
    macie2iface
    Package macie2iface provides an interface to enable mocking the Amazon Macie 2 service client for testing your code.
    Package macie2iface provides an interface to enable mocking the Amazon Macie 2 service client for testing your code.
    Package managedblockchain provides the client and types for making API requests to ManagedBlockchain.
    Package managedblockchain provides the client and types for making API requests to ManagedBlockchain.
    managedblockchainiface
    Package managedblockchainiface provides an interface to enable mocking the Amazon Managed Blockchain service client for testing your code.
    Package managedblockchainiface provides an interface to enable mocking the Amazon Managed Blockchain service client for testing your code.
    Package marketplacecatalog provides the client and types for making API requests to AWS Marketplace Catalog.
    Package marketplacecatalog provides the client and types for making API requests to AWS Marketplace Catalog.
    marketplacecatalogiface
    Package marketplacecatalogiface provides an interface to enable mocking the AWS Marketplace Catalog Service service client for testing your code.
    Package marketplacecatalogiface provides an interface to enable mocking the AWS Marketplace Catalog Service service client for testing your code.
    Package marketplacecommerceanalytics provides the client and types for making API requests to AWS Marketplace Commerce Analytics.
    Package marketplacecommerceanalytics provides the client and types for making API requests to AWS Marketplace Commerce Analytics.
    marketplacecommerceanalyticsiface
    Package marketplacecommerceanalyticsiface provides an interface to enable mocking the AWS Marketplace Commerce Analytics service client for testing your code.
    Package marketplacecommerceanalyticsiface provides an interface to enable mocking the AWS Marketplace Commerce Analytics service client for testing your code.
    Package marketplaceentitlementservice provides the client and types for making API requests to AWS Marketplace Entitlement Service.
    Package marketplaceentitlementservice provides the client and types for making API requests to AWS Marketplace Entitlement Service.
    marketplaceentitlementserviceiface
    Package marketplaceentitlementserviceiface provides an interface to enable mocking the AWS Marketplace Entitlement Service service client for testing your code.
    Package marketplaceentitlementserviceiface provides an interface to enable mocking the AWS Marketplace Entitlement Service service client for testing your code.
    Package marketplacemetering provides the client and types for making API requests to AWSMarketplace Metering.
    Package marketplacemetering provides the client and types for making API requests to AWSMarketplace Metering.
    marketplacemeteringiface
    Package marketplacemeteringiface provides an interface to enable mocking the AWSMarketplace Metering service client for testing your code.
    Package marketplacemeteringiface provides an interface to enable mocking the AWSMarketplace Metering service client for testing your code.
    Package mediaconnect provides the client and types for making API requests to AWS MediaConnect.
    Package mediaconnect provides the client and types for making API requests to AWS MediaConnect.
    mediaconnectiface
    Package mediaconnectiface provides an interface to enable mocking the AWS MediaConnect service client for testing your code.
    Package mediaconnectiface provides an interface to enable mocking the AWS MediaConnect service client for testing your code.
    Package mediaconvert provides the client and types for making API requests to MediaConvert.
    Package mediaconvert provides the client and types for making API requests to MediaConvert.
    mediaconvertiface
    Package mediaconvertiface provides an interface to enable mocking the AWS Elemental MediaConvert service client for testing your code.
    Package mediaconvertiface provides an interface to enable mocking the AWS Elemental MediaConvert service client for testing your code.
    Package medialive provides the client and types for making API requests to MediaLive.
    Package medialive provides the client and types for making API requests to MediaLive.
    medialiveiface
    Package medialiveiface provides an interface to enable mocking the AWS Elemental MediaLive service client for testing your code.
    Package medialiveiface provides an interface to enable mocking the AWS Elemental MediaLive service client for testing your code.
    Package mediapackage provides the client and types for making API requests to MediaPackage.
    Package mediapackage provides the client and types for making API requests to MediaPackage.
    mediapackageiface
    Package mediapackageiface provides an interface to enable mocking the AWS Elemental MediaPackage service client for testing your code.
    Package mediapackageiface provides an interface to enable mocking the AWS Elemental MediaPackage service client for testing your code.
    Package mediapackagevod provides the client and types for making API requests to MediaPackage Vod.
    Package mediapackagevod provides the client and types for making API requests to MediaPackage Vod.
    mediapackagevodiface
    Package mediapackagevodiface provides an interface to enable mocking the AWS Elemental MediaPackage VOD service client for testing your code.
    Package mediapackagevodiface provides an interface to enable mocking the AWS Elemental MediaPackage VOD service client for testing your code.
    Package mediastore provides the client and types for making API requests to MediaStore.
    Package mediastore provides the client and types for making API requests to MediaStore.
    mediastoreiface
    Package mediastoreiface provides an interface to enable mocking the AWS Elemental MediaStore service client for testing your code.
    Package mediastoreiface provides an interface to enable mocking the AWS Elemental MediaStore service client for testing your code.
    Package mediastoredata provides the client and types for making API requests to MediaStore Data.
    Package mediastoredata provides the client and types for making API requests to MediaStore Data.
    mediastoredataiface
    Package mediastoredataiface provides an interface to enable mocking the AWS Elemental MediaStore Data Plane service client for testing your code.
    Package mediastoredataiface provides an interface to enable mocking the AWS Elemental MediaStore Data Plane service client for testing your code.
    Package mediatailor provides the client and types for making API requests to MediaTailor.
    Package mediatailor provides the client and types for making API requests to MediaTailor.
    mediatailoriface
    Package mediatailoriface provides an interface to enable mocking the AWS MediaTailor service client for testing your code.
    Package mediatailoriface provides an interface to enable mocking the AWS MediaTailor service client for testing your code.
    mgn module
    Package migrationhub provides the client and types for making API requests to AWS Migration Hub.
    Package migrationhub provides the client and types for making API requests to AWS Migration Hub.
    migrationhubiface
    Package migrationhubiface provides an interface to enable mocking the AWS Migration Hub service client for testing your code.
    Package migrationhubiface provides an interface to enable mocking the AWS Migration Hub service client for testing your code.
    Package migrationhubconfig provides the client and types for making API requests to AWS Migration Hub Config.
    Package migrationhubconfig provides the client and types for making API requests to AWS Migration Hub Config.
    migrationhubconfigiface
    Package migrationhubconfigiface provides an interface to enable mocking the AWS Migration Hub Config service client for testing your code.
    Package migrationhubconfigiface provides an interface to enable mocking the AWS Migration Hub Config service client for testing your code.
    Package mobile provides the client and types for making API requests to AWS Mobile.
    Package mobile provides the client and types for making API requests to AWS Mobile.
    mobileiface
    Package mobileiface provides an interface to enable mocking the AWS Mobile service client for testing your code.
    Package mobileiface provides an interface to enable mocking the AWS Mobile service client for testing your code.
    Package mobileanalytics provides the client and types for making API requests to Amazon Mobile Analytics.
    Package mobileanalytics provides the client and types for making API requests to Amazon Mobile Analytics.
    mobileanalyticsiface
    Package mobileanalyticsiface provides an interface to enable mocking the Amazon Mobile Analytics service client for testing your code.
    Package mobileanalyticsiface provides an interface to enable mocking the Amazon Mobile Analytics service client for testing your code.
    mq
    Package mq provides the client and types for making API requests to AmazonMQ.
    Package mq provides the client and types for making API requests to AmazonMQ.
    mqiface
    Package mqiface provides an interface to enable mocking the AmazonMQ service client for testing your code.
    Package mqiface provides an interface to enable mocking the AmazonMQ service client for testing your code.
    Package mturk provides the client and types for making API requests to Amazon MTurk.
    Package mturk provides the client and types for making API requests to Amazon MTurk.
    mturkiface
    Package mturkiface provides an interface to enable mocking the Amazon Mechanical Turk service client for testing your code.
    Package mturkiface provides an interface to enable mocking the Amazon Mechanical Turk service client for testing your code.
    mwaa module
    Package neptune provides the client and types for making API requests to Amazon Neptune.
    Package neptune provides the client and types for making API requests to Amazon Neptune.
    neptuneiface
    Package neptuneiface provides an interface to enable mocking the Amazon Neptune service client for testing your code.
    Package neptuneiface provides an interface to enable mocking the Amazon Neptune service client for testing your code.
    Package networkmanager provides the client and types for making API requests to NetworkManager.
    Package networkmanager provides the client and types for making API requests to NetworkManager.
    networkmanageriface
    Package networkmanageriface provides an interface to enable mocking the AWS Network Manager service client for testing your code.
    Package networkmanageriface provides an interface to enable mocking the AWS Network Manager service client for testing your code.
    Package opsworks provides the client and types for making API requests to AWS OpsWorks.
    Package opsworks provides the client and types for making API requests to AWS OpsWorks.
    opsworksiface
    Package opsworksiface provides an interface to enable mocking the AWS OpsWorks service client for testing your code.
    Package opsworksiface provides an interface to enable mocking the AWS OpsWorks service client for testing your code.
    Package opsworkscm provides the client and types for making API requests to OpsWorksCM.
    Package opsworkscm provides the client and types for making API requests to OpsWorksCM.
    opsworkscmiface
    Package opsworkscmiface provides an interface to enable mocking the AWS OpsWorks CM service client for testing your code.
    Package opsworkscmiface provides an interface to enable mocking the AWS OpsWorks CM service client for testing your code.
    Package organizations provides the client and types for making API requests to Organizations.
    Package organizations provides the client and types for making API requests to Organizations.
    organizationsiface
    Package organizationsiface provides an interface to enable mocking the AWS Organizations service client for testing your code.
    Package organizationsiface provides an interface to enable mocking the AWS Organizations service client for testing your code.
    Package outposts provides the client and types for making API requests to Outposts.
    Package outposts provides the client and types for making API requests to Outposts.
    outpostsiface
    Package outpostsiface provides an interface to enable mocking the AWS Outposts service client for testing your code.
    Package outpostsiface provides an interface to enable mocking the AWS Outposts service client for testing your code.
    Package personalize provides the client and types for making API requests to Amazon Personalize.
    Package personalize provides the client and types for making API requests to Amazon Personalize.
    personalizeiface
    Package personalizeiface provides an interface to enable mocking the Amazon Personalize service client for testing your code.
    Package personalizeiface provides an interface to enable mocking the Amazon Personalize service client for testing your code.
    Package personalizeevents provides the client and types for making API requests to Amazon Personalize Events.
    Package personalizeevents provides the client and types for making API requests to Amazon Personalize Events.
    personalizeeventsiface
    Package personalizeeventsiface provides an interface to enable mocking the Amazon Personalize Events service client for testing your code.
    Package personalizeeventsiface provides an interface to enable mocking the Amazon Personalize Events service client for testing your code.
    Package personalizeruntime provides the client and types for making API requests to Amazon Personalize Runtime.
    Package personalizeruntime provides the client and types for making API requests to Amazon Personalize Runtime.
    personalizeruntimeiface
    Package personalizeruntimeiface provides an interface to enable mocking the Amazon Personalize Runtime service client for testing your code.
    Package personalizeruntimeiface provides an interface to enable mocking the Amazon Personalize Runtime service client for testing your code.
    pi
    Package pi provides the client and types for making API requests to AWS PI.
    Package pi provides the client and types for making API requests to AWS PI.
    piiface
    Package piiface provides an interface to enable mocking the AWS Performance Insights service client for testing your code.
    Package piiface provides an interface to enable mocking the AWS Performance Insights service client for testing your code.
    Package pinpoint provides the client and types for making API requests to Amazon Pinpoint.
    Package pinpoint provides the client and types for making API requests to Amazon Pinpoint.
    pinpointiface
    Package pinpointiface provides an interface to enable mocking the Amazon Pinpoint service client for testing your code.
    Package pinpointiface provides an interface to enable mocking the Amazon Pinpoint service client for testing your code.
    Package pinpointemail provides the client and types for making API requests to Pinpoint Email.
    Package pinpointemail provides the client and types for making API requests to Pinpoint Email.
    pinpointemailiface
    Package pinpointemailiface provides an interface to enable mocking the Amazon Pinpoint Email Service service client for testing your code.
    Package pinpointemailiface provides an interface to enable mocking the Amazon Pinpoint Email Service service client for testing your code.
    Package pinpointsmsvoice provides the client and types for making API requests to Pinpoint SMS Voice.
    Package pinpointsmsvoice provides the client and types for making API requests to Pinpoint SMS Voice.
    pinpointsmsvoiceiface
    Package pinpointsmsvoiceiface provides an interface to enable mocking the Amazon Pinpoint SMS and Voice Service service client for testing your code.
    Package pinpointsmsvoiceiface provides an interface to enable mocking the Amazon Pinpoint SMS and Voice Service service client for testing your code.
    Package polly provides the client and types for making API requests to Amazon Polly.
    Package polly provides the client and types for making API requests to Amazon Polly.
    pollyiface
    Package pollyiface provides an interface to enable mocking the Amazon Polly service client for testing your code.
    Package pollyiface provides an interface to enable mocking the Amazon Polly service client for testing your code.
    Package pricing provides the client and types for making API requests to AWS Pricing.
    Package pricing provides the client and types for making API requests to AWS Pricing.
    pricingiface
    Package pricingiface provides an interface to enable mocking the AWS Price List Service service client for testing your code.
    Package pricingiface provides an interface to enable mocking the AWS Price List Service service client for testing your code.
    Package qldb provides the client and types for making API requests to QLDB.
    Package qldb provides the client and types for making API requests to QLDB.
    qldbiface
    Package qldbiface provides an interface to enable mocking the Amazon QLDB service client for testing your code.
    Package qldbiface provides an interface to enable mocking the Amazon QLDB service client for testing your code.
    Package qldbsession provides the client and types for making API requests to QLDB Session.
    Package qldbsession provides the client and types for making API requests to QLDB Session.
    qldbsessioniface
    Package qldbsessioniface provides an interface to enable mocking the Amazon QLDB Session service client for testing your code.
    Package qldbsessioniface provides an interface to enable mocking the Amazon QLDB Session service client for testing your code.
    Package quicksight provides the client and types for making API requests to Amazon QuickSight.
    Package quicksight provides the client and types for making API requests to Amazon QuickSight.
    quicksightiface
    Package quicksightiface provides an interface to enable mocking the Amazon QuickSight service client for testing your code.
    Package quicksightiface provides an interface to enable mocking the Amazon QuickSight service client for testing your code.
    ram
    Package ram provides the client and types for making API requests to RAM.
    Package ram provides the client and types for making API requests to RAM.
    ramiface
    Package ramiface provides an interface to enable mocking the AWS Resource Access Manager service client for testing your code.
    Package ramiface provides an interface to enable mocking the AWS Resource Access Manager service client for testing your code.
    rds
    Package rds provides the client and types for making API requests to Amazon RDS.
    Package rds provides the client and types for making API requests to Amazon RDS.
    rdsiface
    Package rdsiface provides an interface to enable mocking the Amazon Relational Database Service service client for testing your code.
    Package rdsiface provides an interface to enable mocking the Amazon Relational Database Service service client for testing your code.
    rdsutils
    Package rdsutils is used to generate authentication tokens used to connect to a givent Amazon Relational Database Service (RDS) database.
    Package rdsutils is used to generate authentication tokens used to connect to a givent Amazon Relational Database Service (RDS) database.
    Package rdsdata provides the client and types for making API requests to AWS RDS DataService.
    Package rdsdata provides the client and types for making API requests to AWS RDS DataService.
    rdsdataiface
    Package rdsdataiface provides an interface to enable mocking the AWS RDS DataService service client for testing your code.
    Package rdsdataiface provides an interface to enable mocking the AWS RDS DataService service client for testing your code.
    Package redshift provides the client and types for making API requests to Amazon Redshift.
    Package redshift provides the client and types for making API requests to Amazon Redshift.
    redshiftiface
    Package redshiftiface provides an interface to enable mocking the Amazon Redshift service client for testing your code.
    Package redshiftiface provides an interface to enable mocking the Amazon Redshift service client for testing your code.
    redshiftdata module
    Package rekognition provides the client and types for making API requests to Amazon Rekognition.
    Package rekognition provides the client and types for making API requests to Amazon Rekognition.
    rekognitioniface
    Package rekognitioniface provides an interface to enable mocking the Amazon Rekognition service client for testing your code.
    Package rekognitioniface provides an interface to enable mocking the Amazon Rekognition service client for testing your code.
    Package resourcegroups provides the client and types for making API requests to Resource Groups.
    Package resourcegroups provides the client and types for making API requests to Resource Groups.
    resourcegroupsiface
    Package resourcegroupsiface provides an interface to enable mocking the AWS Resource Groups service client for testing your code.
    Package resourcegroupsiface provides an interface to enable mocking the AWS Resource Groups service client for testing your code.
    Package resourcegroupstaggingapi provides the client and types for making API requests to AWS Resource Groups Tagging API.
    Package resourcegroupstaggingapi provides the client and types for making API requests to AWS Resource Groups Tagging API.
    resourcegroupstaggingapiiface
    Package resourcegroupstaggingapiiface provides an interface to enable mocking the AWS Resource Groups Tagging API service client for testing your code.
    Package resourcegroupstaggingapiiface provides an interface to enable mocking the AWS Resource Groups Tagging API service client for testing your code.
    Package robomaker provides the client and types for making API requests to RoboMaker.
    Package robomaker provides the client and types for making API requests to RoboMaker.
    robomakeriface
    Package robomakeriface provides an interface to enable mocking the AWS RoboMaker service client for testing your code.
    Package robomakeriface provides an interface to enable mocking the AWS RoboMaker service client for testing your code.
    Package route53 provides the client and types for making API requests to Route 53.
    Package route53 provides the client and types for making API requests to Route 53.
    route53iface
    Package route53iface provides an interface to enable mocking the Amazon Route 53 service client for testing your code.
    Package route53iface provides an interface to enable mocking the Amazon Route 53 service client for testing your code.
    Package route53domains provides the client and types for making API requests to Amazon Route 53 Domains.
    Package route53domains provides the client and types for making API requests to Amazon Route 53 Domains.
    route53domainsiface
    Package route53domainsiface provides an interface to enable mocking the Amazon Route 53 Domains service client for testing your code.
    Package route53domainsiface provides an interface to enable mocking the Amazon Route 53 Domains service client for testing your code.
    Package route53resolver provides the client and types for making API requests to Route53Resolver.
    Package route53resolver provides the client and types for making API requests to Route53Resolver.
    route53resolveriface
    Package route53resolveriface provides an interface to enable mocking the Amazon Route 53 Resolver service client for testing your code.
    Package route53resolveriface provides an interface to enable mocking the Amazon Route 53 Resolver service client for testing your code.
    s3
    Package s3 provides the client and types for making API requests to Amazon S3.
    Package s3 provides the client and types for making API requests to Amazon S3.
    s3iface
    Package s3iface provides an interface to enable mocking the Amazon Simple Storage Service service client for testing your code.
    Package s3iface provides an interface to enable mocking the Amazon Simple Storage Service service client for testing your code.
    s3manager
    Package s3manager provides utilities to upload and download objects from S3 concurrently.
    Package s3manager provides utilities to upload and download objects from S3 concurrently.
    s3manager/s3manageriface
    Package s3manageriface provides an interface for the s3manager package
    Package s3manageriface provides an interface for the s3manager package
    Package s3control provides the client and types for making API requests to AWS S3 Control.
    Package s3control provides the client and types for making API requests to AWS S3 Control.
    s3controliface
    Package s3controliface provides an interface to enable mocking the AWS S3 Control service client for testing your code.
    Package s3controliface provides an interface to enable mocking the AWS S3 Control service client for testing your code.
    s3outposts module
    Package sagemaker provides the client and types for making API requests to SageMaker.
    Package sagemaker provides the client and types for making API requests to SageMaker.
    sagemakeriface
    Package sagemakeriface provides an interface to enable mocking the Amazon SageMaker Service service client for testing your code.
    Package sagemakeriface provides an interface to enable mocking the Amazon SageMaker Service service client for testing your code.
    Package sagemakera2iruntime provides the client and types for making API requests to Amazon Augmented AI Runtime.
    Package sagemakera2iruntime provides the client and types for making API requests to Amazon Augmented AI Runtime.
    sagemakera2iruntimeiface
    Package sagemakera2iruntimeiface provides an interface to enable mocking the Amazon Augmented AI Runtime service client for testing your code.
    Package sagemakera2iruntimeiface provides an interface to enable mocking the Amazon Augmented AI Runtime service client for testing your code.
    Package sagemakerruntime provides the client and types for making API requests to Amazon SageMaker Runtime.
    Package sagemakerruntime provides the client and types for making API requests to Amazon SageMaker Runtime.
    sagemakerruntimeiface
    Package sagemakerruntimeiface provides an interface to enable mocking the Amazon SageMaker Runtime service client for testing your code.
    Package sagemakerruntimeiface provides an interface to enable mocking the Amazon SageMaker Runtime service client for testing your code.
    Package savingsplans provides the client and types for making API requests to AWSSavingsPlans.
    Package savingsplans provides the client and types for making API requests to AWSSavingsPlans.
    savingsplansiface
    Package savingsplansiface provides an interface to enable mocking the AWS Savings Plans service client for testing your code.
    Package savingsplansiface provides an interface to enable mocking the AWS Savings Plans service client for testing your code.
    Package schemas provides the client and types for making API requests to Schemas.
    Package schemas provides the client and types for making API requests to Schemas.
    schemasiface
    Package schemasiface provides an interface to enable mocking the Schemas service client for testing your code.
    Package schemasiface provides an interface to enable mocking the Schemas service client for testing your code.
    Package secretsmanager provides the client and types for making API requests to AWS Secrets Manager.
    Package secretsmanager provides the client and types for making API requests to AWS Secrets Manager.
    secretsmanageriface
    Package secretsmanageriface provides an interface to enable mocking the AWS Secrets Manager service client for testing your code.
    Package secretsmanageriface provides an interface to enable mocking the AWS Secrets Manager service client for testing your code.
    Package securityhub provides the client and types for making API requests to AWS SecurityHub.
    Package securityhub provides the client and types for making API requests to AWS SecurityHub.
    securityhubiface
    Package securityhubiface provides an interface to enable mocking the AWS SecurityHub service client for testing your code.
    Package securityhubiface provides an interface to enable mocking the AWS SecurityHub service client for testing your code.
    Package serverlessapplicationrepository provides the client and types for making API requests to AWSServerlessApplicationRepository.
    Package serverlessapplicationrepository provides the client and types for making API requests to AWSServerlessApplicationRepository.
    serverlessapplicationrepositoryiface
    Package serverlessapplicationrepositoryiface provides an interface to enable mocking the AWSServerlessApplicationRepository service client for testing your code.
    Package serverlessapplicationrepositoryiface provides an interface to enable mocking the AWSServerlessApplicationRepository service client for testing your code.
    Package servicecatalog provides the client and types for making API requests to AWS Service Catalog.
    Package servicecatalog provides the client and types for making API requests to AWS Service Catalog.
    servicecatalogiface
    Package servicecatalogiface provides an interface to enable mocking the AWS Service Catalog service client for testing your code.
    Package servicecatalogiface provides an interface to enable mocking the AWS Service Catalog service client for testing your code.
    Package servicediscovery provides the client and types for making API requests to ServiceDiscovery.
    Package servicediscovery provides the client and types for making API requests to ServiceDiscovery.
    servicediscoveryiface
    Package servicediscoveryiface provides an interface to enable mocking the AWS Cloud Map service client for testing your code.
    Package servicediscoveryiface provides an interface to enable mocking the AWS Cloud Map service client for testing your code.
    Package servicequotas provides the client and types for making API requests to Service Quotas.
    Package servicequotas provides the client and types for making API requests to Service Quotas.
    servicequotasiface
    Package servicequotasiface provides an interface to enable mocking the Service Quotas service client for testing your code.
    Package servicequotasiface provides an interface to enable mocking the Service Quotas service client for testing your code.
    ses
    Package ses provides the client and types for making API requests to Amazon SES.
    Package ses provides the client and types for making API requests to Amazon SES.
    sesiface
    Package sesiface provides an interface to enable mocking the Amazon Simple Email Service service client for testing your code.
    Package sesiface provides an interface to enable mocking the Amazon Simple Email Service service client for testing your code.
    Package sesv2 provides the client and types for making API requests to Amazon SES V2.
    Package sesv2 provides the client and types for making API requests to Amazon SES V2.
    sesv2iface
    Package sesv2iface provides an interface to enable mocking the Amazon Simple Email Service service client for testing your code.
    Package sesv2iface provides an interface to enable mocking the Amazon Simple Email Service service client for testing your code.
    sfn
    Package sfn provides the client and types for making API requests to AWS SFN.
    Package sfn provides the client and types for making API requests to AWS SFN.
    sfniface
    Package sfniface provides an interface to enable mocking the AWS Step Functions service client for testing your code.
    Package sfniface provides an interface to enable mocking the AWS Step Functions service client for testing your code.
    Package shield provides the client and types for making API requests to AWS Shield.
    Package shield provides the client and types for making API requests to AWS Shield.
    shieldiface
    Package shieldiface provides an interface to enable mocking the AWS Shield service client for testing your code.
    Package shieldiface provides an interface to enable mocking the AWS Shield service client for testing your code.
    Package signer provides the client and types for making API requests to signer.
    Package signer provides the client and types for making API requests to signer.
    signeriface
    Package signeriface provides an interface to enable mocking the AWS Signer service client for testing your code.
    Package signeriface provides an interface to enable mocking the AWS Signer service client for testing your code.
    Package simpledb provides the client and types for making API requests to Amazon SimpleDB.
    Package simpledb provides the client and types for making API requests to Amazon SimpleDB.
    simpledbiface
    Package simpledbiface provides an interface to enable mocking the Amazon SimpleDB service client for testing your code.
    Package simpledbiface provides an interface to enable mocking the Amazon SimpleDB service client for testing your code.
    sms
    Package sms provides the client and types for making API requests to SMS.
    Package sms provides the client and types for making API requests to SMS.
    smsiface
    Package smsiface provides an interface to enable mocking the AWS Server Migration Service service client for testing your code.
    Package smsiface provides an interface to enable mocking the AWS Server Migration Service service client for testing your code.
    Package snowball provides the client and types for making API requests to Amazon Snowball.
    Package snowball provides the client and types for making API requests to Amazon Snowball.
    snowballiface
    Package snowballiface provides an interface to enable mocking the Amazon Import/Export Snowball service client for testing your code.
    Package snowballiface provides an interface to enable mocking the Amazon Import/Export Snowball service client for testing your code.
    sns
    Package sns provides the client and types for making API requests to Amazon SNS.
    Package sns provides the client and types for making API requests to Amazon SNS.
    snsiface
    Package snsiface provides an interface to enable mocking the Amazon Simple Notification Service service client for testing your code.
    Package snsiface provides an interface to enable mocking the Amazon Simple Notification Service service client for testing your code.
    sqs
    Package sqs provides the client and types for making API requests to Amazon SQS.
    Package sqs provides the client and types for making API requests to Amazon SQS.
    sqsiface
    Package sqsiface provides an interface to enable mocking the Amazon Simple Queue Service service client for testing your code.
    Package sqsiface provides an interface to enable mocking the Amazon Simple Queue Service service client for testing your code.
    ssm
    Package ssm provides the client and types for making API requests to Amazon SSM.
    Package ssm provides the client and types for making API requests to Amazon SSM.
    ssmiface
    Package ssmiface provides an interface to enable mocking the Amazon Simple Systems Manager (SSM) service client for testing your code.
    Package ssmiface provides an interface to enable mocking the Amazon Simple Systems Manager (SSM) service client for testing your code.
    sso
    Package sso provides the client and types for making API requests to SSO.
    Package sso provides the client and types for making API requests to SSO.
    ssoiface
    Package ssoiface provides an interface to enable mocking the AWS Single Sign-On service client for testing your code.
    Package ssoiface provides an interface to enable mocking the AWS Single Sign-On service client for testing your code.
    ssoadmin module
    Package ssooidc provides the client and types for making API requests to SSO OIDC.
    Package ssooidc provides the client and types for making API requests to SSO OIDC.
    ssooidciface
    Package ssooidciface provides an interface to enable mocking the AWS SSO OIDC service client for testing your code.
    Package ssooidciface provides an interface to enable mocking the AWS SSO OIDC service client for testing your code.
    Package storagegateway provides the client and types for making API requests to AWS Storage Gateway.
    Package storagegateway provides the client and types for making API requests to AWS Storage Gateway.
    storagegatewayiface
    Package storagegatewayiface provides an interface to enable mocking the AWS Storage Gateway service client for testing your code.
    Package storagegatewayiface provides an interface to enable mocking the AWS Storage Gateway service client for testing your code.
    sts
    Package sts provides the client and types for making API requests to AWS STS.
    Package sts provides the client and types for making API requests to AWS STS.
    stsiface
    Package stsiface provides an interface to enable mocking the AWS Security Token Service service client for testing your code.
    Package stsiface provides an interface to enable mocking the AWS Security Token Service service client for testing your code.
    Package support provides the client and types for making API requests to AWS Support.
    Package support provides the client and types for making API requests to AWS Support.
    supportiface
    Package supportiface provides an interface to enable mocking the AWS Support service client for testing your code.
    Package supportiface provides an interface to enable mocking the AWS Support service client for testing your code.
    swf
    Package swf provides the client and types for making API requests to Amazon SWF.
    Package swf provides the client and types for making API requests to Amazon SWF.
    swfiface
    Package swfiface provides an interface to enable mocking the Amazon Simple Workflow Service service client for testing your code.
    Package swfiface provides an interface to enable mocking the Amazon Simple Workflow Service service client for testing your code.
    Package synthetics provides the client and types for making API requests to Synthetics.
    Package synthetics provides the client and types for making API requests to Synthetics.
    syntheticsiface
    Package syntheticsiface provides an interface to enable mocking the Synthetics service client for testing your code.
    Package syntheticsiface provides an interface to enable mocking the Synthetics service client for testing your code.
    Package textract provides the client and types for making API requests to Amazon Textract.
    Package textract provides the client and types for making API requests to Amazon Textract.
    textractiface
    Package textractiface provides an interface to enable mocking the Amazon Textract service client for testing your code.
    Package textractiface provides an interface to enable mocking the Amazon Textract service client for testing your code.
    Package transcribe provides the client and types for making API requests to Amazon Transcribe Service.
    Package transcribe provides the client and types for making API requests to Amazon Transcribe Service.
    transcribeiface
    Package transcribeiface provides an interface to enable mocking the Amazon Transcribe Service service client for testing your code.
    Package transcribeiface provides an interface to enable mocking the Amazon Transcribe Service service client for testing your code.
    Package transfer provides the client and types for making API requests to AWS Transfer.
    Package transfer provides the client and types for making API requests to AWS Transfer.
    transferiface
    Package transferiface provides an interface to enable mocking the AWS Transfer Family service client for testing your code.
    Package transferiface provides an interface to enable mocking the AWS Transfer Family service client for testing your code.
    Package translate provides the client and types for making API requests to Amazon Translate.
    Package translate provides the client and types for making API requests to Amazon Translate.
    translateiface
    Package translateiface provides an interface to enable mocking the Amazon Translate service client for testing your code.
    Package translateiface provides an interface to enable mocking the Amazon Translate service client for testing your code.
    waf
    Package waf provides the client and types for making API requests to WAF.
    Package waf provides the client and types for making API requests to WAF.
    wafiface
    Package wafiface provides an interface to enable mocking the AWS WAF service client for testing your code.
    Package wafiface provides an interface to enable mocking the AWS WAF service client for testing your code.
    Package wafregional provides the client and types for making API requests to WAF Regional.
    Package wafregional provides the client and types for making API requests to WAF Regional.
    wafregionaliface
    Package wafregionaliface provides an interface to enable mocking the AWS WAF Regional service client for testing your code.
    Package wafregionaliface provides an interface to enable mocking the AWS WAF Regional service client for testing your code.
    Package wafv2 provides the client and types for making API requests to WAFV2.
    Package wafv2 provides the client and types for making API requests to WAFV2.
    wafv2iface
    Package wafv2iface provides an interface to enable mocking the AWS WAFV2 service client for testing your code.
    Package wafv2iface provides an interface to enable mocking the AWS WAFV2 service client for testing your code.
    Package workdocs provides the client and types for making API requests to Amazon WorkDocs.
    Package workdocs provides the client and types for making API requests to Amazon WorkDocs.
    workdocsiface
    Package workdocsiface provides an interface to enable mocking the Amazon WorkDocs service client for testing your code.
    Package workdocsiface provides an interface to enable mocking the Amazon WorkDocs service client for testing your code.
    Package worklink provides the client and types for making API requests to WorkLink.
    Package worklink provides the client and types for making API requests to WorkLink.
    worklinkiface
    Package worklinkiface provides an interface to enable mocking the Amazon WorkLink service client for testing your code.
    Package worklinkiface provides an interface to enable mocking the Amazon WorkLink service client for testing your code.
    Package workmail provides the client and types for making API requests to Amazon WorkMail.
    Package workmail provides the client and types for making API requests to Amazon WorkMail.
    workmailiface
    Package workmailiface provides an interface to enable mocking the Amazon WorkMail service client for testing your code.
    Package workmailiface provides an interface to enable mocking the Amazon WorkMail service client for testing your code.
    Package workmailmessageflow provides the client and types for making API requests to Amazon WorkMail Message Flow.
    Package workmailmessageflow provides the client and types for making API requests to Amazon WorkMail Message Flow.
    workmailmessageflowiface
    Package workmailmessageflowiface provides an interface to enable mocking the Amazon WorkMail Message Flow service client for testing your code.
    Package workmailmessageflowiface provides an interface to enable mocking the Amazon WorkMail Message Flow service client for testing your code.
    Package workspaces provides the client and types for making API requests to Amazon WorkSpaces.
    Package workspaces provides the client and types for making API requests to Amazon WorkSpaces.
    workspacesiface
    Package workspacesiface provides an interface to enable mocking the Amazon WorkSpaces service client for testing your code.
    Package workspacesiface provides an interface to enable mocking the Amazon WorkSpaces service client for testing your code.
    Package xray provides the client and types for making API requests to AWS X-Ray.
    Package xray provides the client and types for making API requests to AWS X-Ray.
    xrayiface
    Package xrayiface provides an interface to enable mocking the AWS X-Ray service client for testing your code.
    Package xrayiface provides an interface to enable mocking the AWS X-Ray service client for testing your code.
    internal
    benchmark Module
    presigned-url Module
    s3shared Module