sdk

package module
v0.18.0 Latest Latest
Warning

This package is not in the latest version of its module.

 Go to latest Published: Dec 12, 2019 License: Apache-2.0 Imports: 0 Imported by: 1

README

Build Status API Reference Apache V2 License

AWS SDK for Go v2

aws-sdk-go-v2 is the Developer Preview (aka beta) for the v2 AWS SDK for the Go programming language. This Developer Preview is provided to receive feedback from the language community on SDK changes prior to the final release. As such users should expect the SDK to release minor version releases that break backwards compatability. The release notes for the breaking change will include information about the breaking change, and how you can migrate to the latest version.

Check out the Issues and Projects for design and updates being made to the SDK. The v2 SDK requires a minimum version of Go 1.12.

We'll be expanding out the Issues and Projects sections with additional changes to the SDK based on your feedback, and SDK's core's improvements. Check the the SDK's CHANGE_LOG for information about the latest updates to the SDK.

Project Status

The SDK is in preview state as we work to design and implement potentially breaking changes to the SDK as we update the SDK's layout and usage patterns based on your feedback. You can also expect periodic service API model updates as well.

We are actively seeking community feedback for several changes to the SDK. Please review our design page on issues that are currently pending community feedback.

Users should expect significant changes that could affect the following (non-exhaustive) areas:

  • Package Locations
    • Includes Location of Service API Types
  • Modularization
  • Credential Providers
  • Paginators
  • Waiters
  • Service Endpoint Resolution
  • Minimum Supported Go Release following the Language Release Policy

Getting started

The best way to get started working with the SDK is to use go get to add the SDK to your Go Workspace or application using Go modules.

go get github.com/aws/aws-sdk-go-v2

Without Go Modules, or in a GOPATH use the /... suffix on the go get to retrieve all of the SDK's dependencies.

go get github.com/aws/aws-sdk-go-v2/...
Hello AWS

This example shows how you can use the v2 SDK to make an API request using the SDK's Amazon DynamoDB client.

package main

import (
	"context"
	"fmt"

	"github.com/aws/aws-sdk-go-v2/aws"
	"github.com/aws/aws-sdk-go-v2/aws/endpoints"
	"github.com/aws/aws-sdk-go-v2/aws/external"
	"github.com/aws/aws-sdk-go-v2/service/dynamodb"
)

func main() {
	// Using the SDK's default configuration, loading additional config
	// and credentials values from the environment variables, shared
	// credentials, and shared configuration files
	cfg, err := external.LoadDefaultAWSConfig()
	if err != nil {
		panic("unable to load SDK config, " + err.Error())
	}

	// Set the AWS Region that the service clients should use
	cfg.Region = endpoints.UsWest2RegionID

	// Using the Config value, create the DynamoDB client
	svc := dynamodb.New(cfg)

	// Build the request with its input parameters
	req := svc.DescribeTableRequest(&dynamodb.DescribeTableInput{
		TableName: aws.String("myTable"),
	})

	// Send the request, and get the response or error back
	resp, err := req.Send(context.Background())
	if err != nil {
		panic("failed to describe table, "+err.Error())
	}

	fmt.Println("Response", resp)
}

Feedback and contributing

The v2 SDK will use GitHub Issues to track feature requests and issues with the SDK. In addition, we'll use GitHub Projects to track large tasks spanning multiple pull requests, such as refactoring the SDK's internal request lifecycle. You can provide feedback to us in several ways.

GitHub issues. To provide feedback or report bugs, file GitHub Issues on the SDK. This is the preferred mechanism to give feedback so that other users can engage in the conversation, +1 issues, etc. Issues you open will be evaluated, and included in our roadmap for the GA launch.

Gitter channel. For more informal discussions or general feedback, check out our Gitter channel for the SDK. The Gitter channel is also a great place to ask general questions, and find help to get started with the 2.0 SDK Developer Preview.

Contributing. You can open pull requests for fixes or additions to the AWS SDK for Go 2.0 Developer Preview release. All pull requests must be submitted under the Apache 2.0 license and will be reviewed by an SDK team member before being merged in. Accompanying unit tests, where possible, are appreciated.

License

This SDK is distributed under the Apache License, Version 2.0, see LICENSE.txt and NOTICE.txt for more information.

Documentation

Overview

Package sdk is the official AWS SDK v2 for the Go programming language.

aws-sdk-go-v2 is the Developer Preview for the v2 of the AWS SDK for the Go programming language. Look for additional documentation and examples to be added.

Getting started

The best way to get started working with the SDK is to use `go get` to add the SDK to your Go Workspace manually. 

go get github.com/aws/aws-sdk-go-v2

You could also use [Dep] to add the SDK to your application's dependencies. Using [Dep] will simplify your update story and help your application keep pinned to specific version of the SDK 

dep ensure --add github.com/aws/aws-sdk-go-v2

Hello AWS

This example shows how you can use the v2 SDK to make an API request using the SDK's Amazon DynamoDB client. 

package main

import (
	"context"
	"github.com/aws/aws-sdk-go-v2/aws"
	"github.com/aws/aws-sdk-go-v2/aws/endpoints"
	"github.com/aws/aws-sdk-go-v2/aws/external"
	"github.com/aws/aws-sdk-go-v2/service/dynamodb"
)

func main() {
	// Using the SDK's default configuration, loading additional config
	// and credentials values from the environment variables, shared
	// credentials, and shared configuration files
	cfg, err := external.LoadDefaultAWSConfig()
	if err != nil {
		panic("unable to load SDK config, " + err.Error())
	}

	// Set the AWS Region that the service clients should use
	cfg.Region = endpoints.UsWest2RegionID

	// Using the Config value, create the DynamoDB client
	svc := dynamodb.New(cfg)

	// Build the request with its input parameters
	req := svc.DescribeTableRequest(&dynamodb.DescribeTableInput{
		TableName: aws.String("myTable"),
	})

	// Send the request, and get the response or error back
	resp, err := req.Send(context.Background())
	if err != nil {
		panic("failed to describe table, "+err.Error())
	}

	fmt.Println("Response", resp)
}

Source Files

View all Source files

Directories

Path Synopsis
aws
Package aws provides the core SDK's utilities and shared types.
 Package aws provides the core SDK's utilities and shared types.
arn
Package arn provides a parser for interacting with Amazon Resource Names.
 Package arn provides a parser for interacting with Amazon Resource Names.
awserr
Package awserr represents API error interface accessors for the SDK.
 Package awserr represents API error interface accessors for the SDK.
defaults
Package defaults is a collection of helpers to retrieve the SDK's default configuration and handlers.
 Package defaults is a collection of helpers to retrieve the SDK's default configuration and handlers.
ec2metadata
Package ec2metadata provides the client for making API calls to the EC2 Instance Metadata service.
 Package ec2metadata provides the client for making API calls to the EC2 Instance Metadata service.
ec2rolecreds
endpointcreds
Package endpointcreds provides support for retrieving credentials from an arbitrary HTTP endpoint.
 Package endpointcreds provides support for retrieving credentials from an arbitrary HTTP endpoint.
endpoints
Package endpoints provides the types and functionality for defining regions and endpoints, as well as querying those definitions.
 Package endpoints provides the types and functionality for defining regions and endpoints, as well as querying those definitions.
external
signer/v2
signer/v4
Package v4 implements signing for AWS V4 signer Provides request signing for request that need to be signed with AWS V4 Signatures.
 Package v4 implements signing for AWS V4 signer Provides request signing for request that need to be signed with AWS V4 Signatures.
stscreds
Package stscreds are credential Providers to retrieve STS AWS credentials.
 Package stscreds are credential Providers to retrieve STS AWS credentials.
protocol/eventstream Module
config module
credentials module
ec2imds module
example
service/dynamodb/createTable Module
service/s3/listObjects Module
service/s3/usingPrivateLink Module
feature
cloudfront/sign Module
dynamodb/attributevalue Module
dynamodb/expression Module
dynamodbstreams/attributevalue Module
ec2/imds Module
ec2/imds/internal/configtesting Module
rds/auth Module
s3/manager Module
internal
awstesting
awstesting/mock
awstesting/unit
Package unit performs initialization and validation for unit tests
 Package unit performs initialization and validation for unit tests
awsutil
ini
Package ini is an LL(1) parser for configuration files.
 Package ini is an LL(1) parser for configuration files.
s3err
sdk
sdkio
shareddefaults
configsources Module
configsources/configtesting Module
endpoints Module
endpoints/config Module
protocoltest/awsrestjson Module
protocoltest/ec2query Module
protocoltest/jsonrpc Module
protocoltest/jsonrpc10 Module
protocoltest/query Module
protocoltest/restxml Module
protocoltest/restxmlwithnamespace Module
protocoltest/smithyrpcv2cbor Module
repotools Module
repotools/changes Module
v4a Module
models
endpoints
Package endpoints contains the models for endpoints that should be used to generate endpoint definition files for the SDK.
 Package endpoints contains the models for endpoints that should be used to generate endpoint definition files for the SDK.
private
model/api
protocol
protocol/ec2query
Package ec2query provides serialization of AWS EC2 requests and responses.
 Package ec2query provides serialization of AWS EC2 requests and responses.
protocol/json
protocol/json/jsonutil
Package jsonutil provides JSON serialization of AWS requests and responses.
 Package jsonutil provides JSON serialization of AWS requests and responses.
protocol/jsonrpc
Package jsonrpc provides JSON RPC utilities for serialization of AWS requests and responses.
 Package jsonrpc provides JSON RPC utilities for serialization of AWS requests and responses.
protocol/query
Package query provides serialization of AWS query requests, and responses.
 Package query provides serialization of AWS query requests, and responses.
protocol/query/queryutil
protocol/rest
Package rest provides RESTful serialization of AWS requests and responses.
 Package rest provides RESTful serialization of AWS requests and responses.
protocol/restjson
Package restjson provides RESTful JSON serialization of AWS requests and responses.
 Package restjson provides RESTful JSON serialization of AWS requests and responses.
protocol/restxml
Package restxml provides RESTful XML serialization of AWS requests and responses.
 Package restxml provides RESTful XML serialization of AWS requests and responses.
protocol/xml
protocol/xml/xmlutil
Package xmlutil provides XML serialization of AWS requests and responses.
 Package xmlutil provides XML serialization of AWS requests and responses.
util
Package service contains automatically generated AWS clients.
 Package service contains automatically generated AWS clients.
accessanalyzer
Package accessanalyzer provides the client and types for making API requests to Access Analyzer.
 Package accessanalyzer provides the client and types for making API requests to Access Analyzer.
accessanalyzer/accessanalyzeriface
Package accessanalyzeriface provides an interface to enable mocking the Access Analyzer service client for testing your code.
 Package accessanalyzeriface provides an interface to enable mocking the Access Analyzer service client for testing your code.
acm
Package acm provides the client and types for making API requests to ACM.
 Package acm provides the client and types for making API requests to ACM.
acm/acmiface
Package acmiface provides an interface to enable mocking the AWS Certificate Manager service client for testing your code.
 Package acmiface provides an interface to enable mocking the AWS Certificate Manager service client for testing your code.
acmpca
Package acmpca provides the client and types for making API requests to ACM-PCA.
 Package acmpca provides the client and types for making API requests to ACM-PCA.
acmpca/acmpcaiface
Package acmpcaiface provides an interface to enable mocking the AWS Certificate Manager Private Certificate Authority service client for testing your code.
 Package acmpcaiface provides an interface to enable mocking the AWS Certificate Manager Private Certificate Authority service client for testing your code.
alexaforbusiness
Package alexaforbusiness provides the client and types for making API requests to Alexa For Business.
 Package alexaforbusiness provides the client and types for making API requests to Alexa For Business.
alexaforbusiness/alexaforbusinessiface
Package alexaforbusinessiface provides an interface to enable mocking the Alexa For Business service client for testing your code.
 Package alexaforbusinessiface provides an interface to enable mocking the Alexa For Business service client for testing your code.
amplify
Package amplify provides the client and types for making API requests to Amplify.
 Package amplify provides the client and types for making API requests to Amplify.
amplify/amplifyiface
Package amplifyiface provides an interface to enable mocking the AWS Amplify service client for testing your code.
 Package amplifyiface provides an interface to enable mocking the AWS Amplify service client for testing your code.
apigateway
Package apigateway provides the client and types for making API requests to Amazon API Gateway.
 Package apigateway provides the client and types for making API requests to Amazon API Gateway.
apigateway/apigatewayiface
Package apigatewayiface provides an interface to enable mocking the Amazon API Gateway service client for testing your code.
 Package apigatewayiface provides an interface to enable mocking the Amazon API Gateway service client for testing your code.
apigatewaymanagementapi
Package apigatewaymanagementapi provides the client and types for making API requests to AmazonApiGatewayManagementApi.
 Package apigatewaymanagementapi provides the client and types for making API requests to AmazonApiGatewayManagementApi.
apigatewaymanagementapi/apigatewaymanagementapiiface
Package apigatewaymanagementapiiface provides an interface to enable mocking the AmazonApiGatewayManagementApi service client for testing your code.
 Package apigatewaymanagementapiiface provides an interface to enable mocking the AmazonApiGatewayManagementApi service client for testing your code.
apigatewayv2
Package apigatewayv2 provides the client and types for making API requests to AmazonApiGatewayV2.
 Package apigatewayv2 provides the client and types for making API requests to AmazonApiGatewayV2.
apigatewayv2/apigatewayv2iface
Package apigatewayv2iface provides an interface to enable mocking the AmazonApiGatewayV2 service client for testing your code.
 Package apigatewayv2iface provides an interface to enable mocking the AmazonApiGatewayV2 service client for testing your code.
appconfig
Package appconfig provides the client and types for making API requests to AppConfig.
 Package appconfig provides the client and types for making API requests to AppConfig.
appconfig/appconfigiface
Package appconfigiface provides an interface to enable mocking the Amazon AppConfig service client for testing your code.
 Package appconfigiface provides an interface to enable mocking the Amazon AppConfig service client for testing your code.
applicationautoscaling
Package applicationautoscaling provides the client and types for making API requests to Application Auto Scaling.
 Package applicationautoscaling provides the client and types for making API requests to Application Auto Scaling.
applicationautoscaling/applicationautoscalingiface
Package applicationautoscalingiface provides an interface to enable mocking the Application Auto Scaling service client for testing your code.
 Package applicationautoscalingiface provides an interface to enable mocking the Application Auto Scaling service client for testing your code.
applicationdiscoveryservice
Package applicationdiscoveryservice provides the client and types for making API requests to AWS Application Discovery Service.
 Package applicationdiscoveryservice provides the client and types for making API requests to AWS Application Discovery Service.
applicationdiscoveryservice/applicationdiscoveryserviceiface
Package applicationdiscoveryserviceiface provides an interface to enable mocking the AWS Application Discovery Service service client for testing your code.
 Package applicationdiscoveryserviceiface provides an interface to enable mocking the AWS Application Discovery Service service client for testing your code.
applicationinsights
Package applicationinsights provides the client and types for making API requests to Application Insights.
 Package applicationinsights provides the client and types for making API requests to Application Insights.
applicationinsights/applicationinsightsiface
Package applicationinsightsiface provides an interface to enable mocking the Amazon CloudWatch Application Insights service client for testing your code.
 Package applicationinsightsiface provides an interface to enable mocking the Amazon CloudWatch Application Insights service client for testing your code.
appmesh
Package appmesh provides the client and types for making API requests to AWS App Mesh.
 Package appmesh provides the client and types for making API requests to AWS App Mesh.
appmesh/appmeshiface
Package appmeshiface provides an interface to enable mocking the AWS App Mesh service client for testing your code.
 Package appmeshiface provides an interface to enable mocking the AWS App Mesh service client for testing your code.
appstream
Package appstream provides the client and types for making API requests to Amazon AppStream.
 Package appstream provides the client and types for making API requests to Amazon AppStream.
appstream/appstreamiface
Package appstreamiface provides an interface to enable mocking the Amazon AppStream service client for testing your code.
 Package appstreamiface provides an interface to enable mocking the Amazon AppStream service client for testing your code.
appsync
Package appsync provides the client and types for making API requests to AWSAppSync.
 Package appsync provides the client and types for making API requests to AWSAppSync.
appsync/appsynciface
Package appsynciface provides an interface to enable mocking the AWS AppSync service client for testing your code.
 Package appsynciface provides an interface to enable mocking the AWS AppSync service client for testing your code.
athena
Package athena provides the client and types for making API requests to Amazon Athena.
 Package athena provides the client and types for making API requests to Amazon Athena.
athena/athenaiface
Package athenaiface provides an interface to enable mocking the Amazon Athena service client for testing your code.
 Package athenaiface provides an interface to enable mocking the Amazon Athena service client for testing your code.
autoscaling
Package autoscaling provides the client and types for making API requests to Auto Scaling.
 Package autoscaling provides the client and types for making API requests to Auto Scaling.
autoscaling/autoscalingiface
Package autoscalingiface provides an interface to enable mocking the Auto Scaling service client for testing your code.
 Package autoscalingiface provides an interface to enable mocking the Auto Scaling service client for testing your code.
autoscalingplans
Package autoscalingplans provides the client and types for making API requests to AWS Auto Scaling Plans.
 Package autoscalingplans provides the client and types for making API requests to AWS Auto Scaling Plans.
autoscalingplans/autoscalingplansiface
Package autoscalingplansiface provides an interface to enable mocking the AWS Auto Scaling Plans service client for testing your code.
 Package autoscalingplansiface provides an interface to enable mocking the AWS Auto Scaling Plans service client for testing your code.
backup
Package backup provides the client and types for making API requests to AWS Backup.
 Package backup provides the client and types for making API requests to AWS Backup.
backup/backupiface
Package backupiface provides an interface to enable mocking the AWS Backup service client for testing your code.
 Package backupiface provides an interface to enable mocking the AWS Backup service client for testing your code.
batch
Package batch provides the client and types for making API requests to AWS Batch.
 Package batch provides the client and types for making API requests to AWS Batch.
batch/batchiface
Package batchiface provides an interface to enable mocking the AWS Batch service client for testing your code.
 Package batchiface provides an interface to enable mocking the AWS Batch service client for testing your code.
budgets
Package budgets provides the client and types for making API requests to AWSBudgets.
 Package budgets provides the client and types for making API requests to AWSBudgets.
budgets/budgetsiface
Package budgetsiface provides an interface to enable mocking the AWS Budgets service client for testing your code.
 Package budgetsiface provides an interface to enable mocking the AWS Budgets service client for testing your code.
chime
Package chime provides the client and types for making API requests to Amazon Chime.
 Package chime provides the client and types for making API requests to Amazon Chime.
chime/chimeiface
Package chimeiface provides an interface to enable mocking the Amazon Chime service client for testing your code.
 Package chimeiface provides an interface to enable mocking the Amazon Chime service client for testing your code.
cloud9
Package cloud9 provides the client and types for making API requests to AWS Cloud9.
 Package cloud9 provides the client and types for making API requests to AWS Cloud9.
cloud9/cloud9iface
Package cloud9iface provides an interface to enable mocking the AWS Cloud9 service client for testing your code.
 Package cloud9iface provides an interface to enable mocking the AWS Cloud9 service client for testing your code.
clouddirectory
Package clouddirectory provides the client and types for making API requests to Amazon CloudDirectory.
 Package clouddirectory provides the client and types for making API requests to Amazon CloudDirectory.
clouddirectory/clouddirectoryiface
Package clouddirectoryiface provides an interface to enable mocking the Amazon CloudDirectory service client for testing your code.
 Package clouddirectoryiface provides an interface to enable mocking the Amazon CloudDirectory service client for testing your code.
cloudformation
Package cloudformation provides the client and types for making API requests to AWS CloudFormation.
 Package cloudformation provides the client and types for making API requests to AWS CloudFormation.
cloudformation/cloudformationiface
Package cloudformationiface provides an interface to enable mocking the AWS CloudFormation service client for testing your code.
 Package cloudformationiface provides an interface to enable mocking the AWS CloudFormation service client for testing your code.
cloudfront
Package cloudfront provides the client and types for making API requests to CloudFront.
 Package cloudfront provides the client and types for making API requests to CloudFront.
cloudfront/cloudfrontiface
Package cloudfrontiface provides an interface to enable mocking the Amazon CloudFront service client for testing your code.
 Package cloudfrontiface provides an interface to enable mocking the Amazon CloudFront service client for testing your code.
cloudfront/sign
Package sign provides utilities to generate signed URLs for Amazon CloudFront.
 Package sign provides utilities to generate signed URLs for Amazon CloudFront.
cloudhsm
Package cloudhsm provides the client and types for making API requests to CloudHSM.
 Package cloudhsm provides the client and types for making API requests to CloudHSM.
cloudhsm/cloudhsmiface
Package cloudhsmiface provides an interface to enable mocking the Amazon CloudHSM service client for testing your code.
 Package cloudhsmiface provides an interface to enable mocking the Amazon CloudHSM service client for testing your code.
cloudhsmv2
Package cloudhsmv2 provides the client and types for making API requests to CloudHSM V2.
 Package cloudhsmv2 provides the client and types for making API requests to CloudHSM V2.
cloudhsmv2/cloudhsmv2iface
Package cloudhsmv2iface provides an interface to enable mocking the AWS CloudHSM V2 service client for testing your code.
 Package cloudhsmv2iface provides an interface to enable mocking the AWS CloudHSM V2 service client for testing your code.
cloudsearch
Package cloudsearch provides the client and types for making API requests to Amazon CloudSearch.
 Package cloudsearch provides the client and types for making API requests to Amazon CloudSearch.
cloudsearch/cloudsearchiface
Package cloudsearchiface provides an interface to enable mocking the Amazon CloudSearch service client for testing your code.
 Package cloudsearchiface provides an interface to enable mocking the Amazon CloudSearch service client for testing your code.
cloudsearchdomain
Package cloudsearchdomain provides the client and types for making API requests to Amazon CloudSearch Domain.
 Package cloudsearchdomain provides the client and types for making API requests to Amazon CloudSearch Domain.
cloudsearchdomain/cloudsearchdomainiface
Package cloudsearchdomainiface provides an interface to enable mocking the Amazon CloudSearch Domain service client for testing your code.
 Package cloudsearchdomainiface provides an interface to enable mocking the Amazon CloudSearch Domain service client for testing your code.
cloudtrail
Package cloudtrail provides the client and types for making API requests to CloudTrail.
 Package cloudtrail provides the client and types for making API requests to CloudTrail.
cloudtrail/cloudtrailiface
Package cloudtrailiface provides an interface to enable mocking the AWS CloudTrail service client for testing your code.
 Package cloudtrailiface provides an interface to enable mocking the AWS CloudTrail service client for testing your code.
cloudwatch
Package cloudwatch provides the client and types for making API requests to CloudWatch.
 Package cloudwatch provides the client and types for making API requests to CloudWatch.
cloudwatch/cloudwatchiface
Package cloudwatchiface provides an interface to enable mocking the Amazon CloudWatch service client for testing your code.
 Package cloudwatchiface provides an interface to enable mocking the Amazon CloudWatch service client for testing your code.
cloudwatchevents
Package cloudwatchevents provides the client and types for making API requests to Amazon CloudWatch Events.
 Package cloudwatchevents provides the client and types for making API requests to Amazon CloudWatch Events.
cloudwatchevents/cloudwatcheventsiface
Package cloudwatcheventsiface provides an interface to enable mocking the Amazon CloudWatch Events service client for testing your code.
 Package cloudwatcheventsiface provides an interface to enable mocking the Amazon CloudWatch Events service client for testing your code.
cloudwatchlogs
Package cloudwatchlogs provides the client and types for making API requests to Amazon CloudWatch Logs.
 Package cloudwatchlogs provides the client and types for making API requests to Amazon CloudWatch Logs.
cloudwatchlogs/cloudwatchlogsiface
Package cloudwatchlogsiface provides an interface to enable mocking the Amazon CloudWatch Logs service client for testing your code.
 Package cloudwatchlogsiface provides an interface to enable mocking the Amazon CloudWatch Logs service client for testing your code.
codebuild
Package codebuild provides the client and types for making API requests to AWS CodeBuild.
 Package codebuild provides the client and types for making API requests to AWS CodeBuild.
codebuild/codebuildiface
Package codebuildiface provides an interface to enable mocking the AWS CodeBuild service client for testing your code.
 Package codebuildiface provides an interface to enable mocking the AWS CodeBuild service client for testing your code.
codecommit
Package codecommit provides the client and types for making API requests to CodeCommit.
 Package codecommit provides the client and types for making API requests to CodeCommit.
codecommit/codecommitiface
Package codecommitiface provides an interface to enable mocking the AWS CodeCommit service client for testing your code.
 Package codecommitiface provides an interface to enable mocking the AWS CodeCommit service client for testing your code.
codedeploy
Package codedeploy provides the client and types for making API requests to CodeDeploy.
 Package codedeploy provides the client and types for making API requests to CodeDeploy.
codedeploy/codedeployiface
Package codedeployiface provides an interface to enable mocking the AWS CodeDeploy service client for testing your code.
 Package codedeployiface provides an interface to enable mocking the AWS CodeDeploy service client for testing your code.
codeguruprofiler
Package codeguruprofiler provides the client and types for making API requests to Amazon CodeGuru Profiler.
 Package codeguruprofiler provides the client and types for making API requests to Amazon CodeGuru Profiler.
codeguruprofiler/codeguruprofileriface
Package codeguruprofileriface provides an interface to enable mocking the Amazon CodeGuru Profiler service client for testing your code.
 Package codeguruprofileriface provides an interface to enable mocking the Amazon CodeGuru Profiler service client for testing your code.
codegurureviewer
Package codegurureviewer provides the client and types for making API requests to CodeGuruReviewer.
 Package codegurureviewer provides the client and types for making API requests to CodeGuruReviewer.
codegurureviewer/codegururevieweriface
Package codegururevieweriface provides an interface to enable mocking the Amazon CodeGuru Reviewer service client for testing your code.
 Package codegururevieweriface provides an interface to enable mocking the Amazon CodeGuru Reviewer service client for testing your code.
codepipeline
Package codepipeline provides the client and types for making API requests to CodePipeline.
 Package codepipeline provides the client and types for making API requests to CodePipeline.
codepipeline/codepipelineiface
Package codepipelineiface provides an interface to enable mocking the AWS CodePipeline service client for testing your code.
 Package codepipelineiface provides an interface to enable mocking the AWS CodePipeline service client for testing your code.
codestar
Package codestar provides the client and types for making API requests to CodeStar.
 Package codestar provides the client and types for making API requests to CodeStar.
codestar/codestariface
Package codestariface provides an interface to enable mocking the AWS CodeStar service client for testing your code.
 Package codestariface provides an interface to enable mocking the AWS CodeStar service client for testing your code.
codestarnotifications
Package codestarnotifications provides the client and types for making API requests to AWS CodeStar Notifications.
 Package codestarnotifications provides the client and types for making API requests to AWS CodeStar Notifications.
codestarnotifications/codestarnotificationsiface
Package codestarnotificationsiface provides an interface to enable mocking the AWS CodeStar Notifications service client for testing your code.
 Package codestarnotificationsiface provides an interface to enable mocking the AWS CodeStar Notifications service client for testing your code.
cognitoidentity
Package cognitoidentity provides the client and types for making API requests to Amazon Cognito Identity.
 Package cognitoidentity provides the client and types for making API requests to Amazon Cognito Identity.
cognitoidentity/cognitoidentityiface
Package cognitoidentityiface provides an interface to enable mocking the Amazon Cognito Identity service client for testing your code.
 Package cognitoidentityiface provides an interface to enable mocking the Amazon Cognito Identity service client for testing your code.
cognitoidentityprovider
Package cognitoidentityprovider provides the client and types for making API requests to Amazon Cognito Identity Provider.
 Package cognitoidentityprovider provides the client and types for making API requests to Amazon Cognito Identity Provider.
cognitoidentityprovider/cognitoidentityprovideriface
Package cognitoidentityprovideriface provides an interface to enable mocking the Amazon Cognito Identity Provider service client for testing your code.
 Package cognitoidentityprovideriface provides an interface to enable mocking the Amazon Cognito Identity Provider service client for testing your code.
cognitosync
Package cognitosync provides the client and types for making API requests to Amazon Cognito Sync.
 Package cognitosync provides the client and types for making API requests to Amazon Cognito Sync.
cognitosync/cognitosynciface
Package cognitosynciface provides an interface to enable mocking the Amazon Cognito Sync service client for testing your code.
 Package cognitosynciface provides an interface to enable mocking the Amazon Cognito Sync service client for testing your code.
comprehend
Package comprehend provides the client and types for making API requests to Amazon Comprehend.
 Package comprehend provides the client and types for making API requests to Amazon Comprehend.
comprehend/comprehendiface
Package comprehendiface provides an interface to enable mocking the Amazon Comprehend service client for testing your code.
 Package comprehendiface provides an interface to enable mocking the Amazon Comprehend service client for testing your code.
comprehendmedical
Package comprehendmedical provides the client and types for making API requests to ComprehendMedical.
 Package comprehendmedical provides the client and types for making API requests to ComprehendMedical.
comprehendmedical/comprehendmedicaliface
Package comprehendmedicaliface provides an interface to enable mocking the AWS Comprehend Medical service client for testing your code.
 Package comprehendmedicaliface provides an interface to enable mocking the AWS Comprehend Medical service client for testing your code.
computeoptimizer
Package computeoptimizer provides the client and types for making API requests to AWS Compute Optimizer.
 Package computeoptimizer provides the client and types for making API requests to AWS Compute Optimizer.
computeoptimizer/computeoptimizeriface
Package computeoptimizeriface provides an interface to enable mocking the AWS Compute Optimizer service client for testing your code.
 Package computeoptimizeriface provides an interface to enable mocking the AWS Compute Optimizer service client for testing your code.
configservice
Package configservice provides the client and types for making API requests to Config Service.
 Package configservice provides the client and types for making API requests to Config Service.
configservice/configserviceiface
Package configserviceiface provides an interface to enable mocking the AWS Config service client for testing your code.
 Package configserviceiface provides an interface to enable mocking the AWS Config service client for testing your code.
connect
Package connect provides the client and types for making API requests to Amazon Connect.
 Package connect provides the client and types for making API requests to Amazon Connect.
connect/connectiface
Package connectiface provides an interface to enable mocking the Amazon Connect Service service client for testing your code.
 Package connectiface provides an interface to enable mocking the Amazon Connect Service service client for testing your code.
connectparticipant
Package connectparticipant provides the client and types for making API requests to Amazon Connect Participant.
 Package connectparticipant provides the client and types for making API requests to Amazon Connect Participant.
connectparticipant/connectparticipantiface
Package connectparticipantiface provides an interface to enable mocking the Amazon Connect Participant Service service client for testing your code.
 Package connectparticipantiface provides an interface to enable mocking the Amazon Connect Participant Service service client for testing your code.
costandusagereportservice
Package costandusagereportservice provides the client and types for making API requests to AWS Cost and Usage Report Service.
 Package costandusagereportservice provides the client and types for making API requests to AWS Cost and Usage Report Service.
costandusagereportservice/costandusagereportserviceiface
Package costandusagereportserviceiface provides an interface to enable mocking the AWS Cost and Usage Report Service service client for testing your code.
 Package costandusagereportserviceiface provides an interface to enable mocking the AWS Cost and Usage Report Service service client for testing your code.
costexplorer
Package costexplorer provides the client and types for making API requests to AWS Cost Explorer.
 Package costexplorer provides the client and types for making API requests to AWS Cost Explorer.
costexplorer/costexploreriface
Package costexploreriface provides an interface to enable mocking the AWS Cost Explorer Service service client for testing your code.
 Package costexploreriface provides an interface to enable mocking the AWS Cost Explorer Service service client for testing your code.
databasemigrationservice
Package databasemigrationservice provides the client and types for making API requests to AWS Database Migration Service.
 Package databasemigrationservice provides the client and types for making API requests to AWS Database Migration Service.
databasemigrationservice/databasemigrationserviceiface
Package databasemigrationserviceiface provides an interface to enable mocking the AWS Database Migration Service service client for testing your code.
 Package databasemigrationserviceiface provides an interface to enable mocking the AWS Database Migration Service service client for testing your code.
dataexchange
Package dataexchange provides the client and types for making API requests to AWS Data Exchange.
 Package dataexchange provides the client and types for making API requests to AWS Data Exchange.
dataexchange/dataexchangeiface
Package dataexchangeiface provides an interface to enable mocking the AWS Data Exchange service client for testing your code.
 Package dataexchangeiface provides an interface to enable mocking the AWS Data Exchange service client for testing your code.
datapipeline
Package datapipeline provides the client and types for making API requests to AWS Data Pipeline.
 Package datapipeline provides the client and types for making API requests to AWS Data Pipeline.
datapipeline/datapipelineiface
Package datapipelineiface provides an interface to enable mocking the AWS Data Pipeline service client for testing your code.
 Package datapipelineiface provides an interface to enable mocking the AWS Data Pipeline service client for testing your code.
datasync
Package datasync provides the client and types for making API requests to DataSync.
 Package datasync provides the client and types for making API requests to DataSync.
datasync/datasynciface
Package datasynciface provides an interface to enable mocking the AWS DataSync service client for testing your code.
 Package datasynciface provides an interface to enable mocking the AWS DataSync service client for testing your code.
dax
Package dax provides the client and types for making API requests to Amazon DAX.
 Package dax provides the client and types for making API requests to Amazon DAX.
dax/daxiface
Package daxiface provides an interface to enable mocking the Amazon DynamoDB Accelerator (DAX) service client for testing your code.
 Package daxiface provides an interface to enable mocking the Amazon DynamoDB Accelerator (DAX) service client for testing your code.
devicefarm
Package devicefarm provides the client and types for making API requests to AWS Device Farm.
 Package devicefarm provides the client and types for making API requests to AWS Device Farm.
devicefarm/devicefarmiface
Package devicefarmiface provides an interface to enable mocking the AWS Device Farm service client for testing your code.
 Package devicefarmiface provides an interface to enable mocking the AWS Device Farm service client for testing your code.
directconnect
Package directconnect provides the client and types for making API requests to AWS Direct Connect.
 Package directconnect provides the client and types for making API requests to AWS Direct Connect.
directconnect/directconnectiface
Package directconnectiface provides an interface to enable mocking the AWS Direct Connect service client for testing your code.
 Package directconnectiface provides an interface to enable mocking the AWS Direct Connect service client for testing your code.
directoryservice
Package directoryservice provides the client and types for making API requests to Directory Service.
 Package directoryservice provides the client and types for making API requests to Directory Service.
directoryservice/directoryserviceiface
Package directoryserviceiface provides an interface to enable mocking the AWS Directory Service service client for testing your code.
 Package directoryserviceiface provides an interface to enable mocking the AWS Directory Service service client for testing your code.
dlm
Package dlm provides the client and types for making API requests to Amazon DLM.
 Package dlm provides the client and types for making API requests to Amazon DLM.
dlm/dlmiface
Package dlmiface provides an interface to enable mocking the Amazon Data Lifecycle Manager service client for testing your code.
 Package dlmiface provides an interface to enable mocking the Amazon Data Lifecycle Manager service client for testing your code.
docdb
Package docdb provides the client and types for making API requests to Amazon DocDB.
 Package docdb provides the client and types for making API requests to Amazon DocDB.
docdb/docdbiface
Package docdbiface provides an interface to enable mocking the Amazon DocumentDB with MongoDB compatibility service client for testing your code.
 Package docdbiface provides an interface to enable mocking the Amazon DocumentDB with MongoDB compatibility service client for testing your code.
dynamodb
Package dynamodb provides the client and types for making API requests to DynamoDB.
 Package dynamodb provides the client and types for making API requests to DynamoDB.
dynamodb/dynamodbattribute
Package dynamodbattribute provides marshaling and unmarshaling utilities to convert between Go types and dynamodb.AttributeValues.
 Package dynamodbattribute provides marshaling and unmarshaling utilities to convert between Go types and dynamodb.AttributeValues.
dynamodb/dynamodbiface
Package dynamodbiface provides an interface to enable mocking the Amazon DynamoDB service client for testing your code.
 Package dynamodbiface provides an interface to enable mocking the Amazon DynamoDB service client for testing your code.
dynamodb/expression
Package expression provides types and functions to create Amazon DynamoDB Expression strings, ExpressionAttributeNames maps, and ExpressionAttributeValues maps.
 Package expression provides types and functions to create Amazon DynamoDB Expression strings, ExpressionAttributeNames maps, and ExpressionAttributeValues maps.
dynamodbstreams
Package dynamodbstreams provides the client and types for making API requests to Amazon DynamoDB Streams.
 Package dynamodbstreams provides the client and types for making API requests to Amazon DynamoDB Streams.
dynamodbstreams/dynamodbstreamsiface
Package dynamodbstreamsiface provides an interface to enable mocking the Amazon DynamoDB Streams service client for testing your code.
 Package dynamodbstreamsiface provides an interface to enable mocking the Amazon DynamoDB Streams service client for testing your code.
ebs
Package ebs provides the client and types for making API requests to Amazon EBS.
 Package ebs provides the client and types for making API requests to Amazon EBS.
ebs/ebsiface
Package ebsiface provides an interface to enable mocking the Amazon Elastic Block Store service client for testing your code.
 Package ebsiface provides an interface to enable mocking the Amazon Elastic Block Store service client for testing your code.
ec2
Package ec2 provides the client and types for making API requests to Amazon EC2.
 Package ec2 provides the client and types for making API requests to Amazon EC2.
ec2/ec2iface
Package ec2iface provides an interface to enable mocking the Amazon Elastic Compute Cloud service client for testing your code.
 Package ec2iface provides an interface to enable mocking the Amazon Elastic Compute Cloud service client for testing your code.
ec2instanceconnect
Package ec2instanceconnect provides the client and types for making API requests to EC2 Instance Connect.
 Package ec2instanceconnect provides the client and types for making API requests to EC2 Instance Connect.
ec2instanceconnect/ec2instanceconnectiface
Package ec2instanceconnectiface provides an interface to enable mocking the AWS EC2 Instance Connect service client for testing your code.
 Package ec2instanceconnectiface provides an interface to enable mocking the AWS EC2 Instance Connect service client for testing your code.
ecr
Package ecr provides the client and types for making API requests to Amazon ECR.
 Package ecr provides the client and types for making API requests to Amazon ECR.
ecr/ecriface
Package ecriface provides an interface to enable mocking the Amazon EC2 Container Registry service client for testing your code.
 Package ecriface provides an interface to enable mocking the Amazon EC2 Container Registry service client for testing your code.
ecs
Package ecs provides the client and types for making API requests to Amazon ECS.
 Package ecs provides the client and types for making API requests to Amazon ECS.
ecs/ecsiface
Package ecsiface provides an interface to enable mocking the Amazon EC2 Container Service service client for testing your code.
 Package ecsiface provides an interface to enable mocking the Amazon EC2 Container Service service client for testing your code.
efs
Package efs provides the client and types for making API requests to EFS.
 Package efs provides the client and types for making API requests to EFS.
efs/efsiface
Package efsiface provides an interface to enable mocking the Amazon Elastic File System service client for testing your code.
 Package efsiface provides an interface to enable mocking the Amazon Elastic File System service client for testing your code.
eks
Package eks provides the client and types for making API requests to Amazon EKS.
 Package eks provides the client and types for making API requests to Amazon EKS.
eks/eksiface
Package eksiface provides an interface to enable mocking the Amazon Elastic Kubernetes Service service client for testing your code.
 Package eksiface provides an interface to enable mocking the Amazon Elastic Kubernetes Service service client for testing your code.
elasticache
Package elasticache provides the client and types for making API requests to Amazon ElastiCache.
 Package elasticache provides the client and types for making API requests to Amazon ElastiCache.
elasticache/elasticacheiface
Package elasticacheiface provides an interface to enable mocking the Amazon ElastiCache service client for testing your code.
 Package elasticacheiface provides an interface to enable mocking the Amazon ElastiCache service client for testing your code.
elasticbeanstalk
Package elasticbeanstalk provides the client and types for making API requests to Elastic Beanstalk.
 Package elasticbeanstalk provides the client and types for making API requests to Elastic Beanstalk.
elasticbeanstalk/elasticbeanstalkiface
Package elasticbeanstalkiface provides an interface to enable mocking the AWS Elastic Beanstalk service client for testing your code.
 Package elasticbeanstalkiface provides an interface to enable mocking the AWS Elastic Beanstalk service client for testing your code.
elasticinference
Package elasticinference provides the client and types for making API requests to Amazon Elastic Inference.
 Package elasticinference provides the client and types for making API requests to Amazon Elastic Inference.
elasticinference/elasticinferenceiface
Package elasticinferenceiface provides an interface to enable mocking the Amazon Elastic Inference service client for testing your code.
 Package elasticinferenceiface provides an interface to enable mocking the Amazon Elastic Inference service client for testing your code.
elasticloadbalancing
Package elasticloadbalancing provides the client and types for making API requests to Elastic Load Balancing.
 Package elasticloadbalancing provides the client and types for making API requests to Elastic Load Balancing.
elasticloadbalancing/elasticloadbalancingiface
Package elasticloadbalancingiface provides an interface to enable mocking the Elastic Load Balancing service client for testing your code.
 Package elasticloadbalancingiface provides an interface to enable mocking the Elastic Load Balancing service client for testing your code.
elasticloadbalancingv2
Package elasticloadbalancingv2 provides the client and types for making API requests to Elastic Load Balancing v2.
 Package elasticloadbalancingv2 provides the client and types for making API requests to Elastic Load Balancing v2.
elasticloadbalancingv2/elasticloadbalancingv2iface
Package elasticloadbalancingv2iface provides an interface to enable mocking the Elastic Load Balancing service client for testing your code.
 Package elasticloadbalancingv2iface provides an interface to enable mocking the Elastic Load Balancing service client for testing your code.
elasticsearchservice
Package elasticsearchservice provides the client and types for making API requests to Amazon Elasticsearch Service.
 Package elasticsearchservice provides the client and types for making API requests to Amazon Elasticsearch Service.
elasticsearchservice/elasticsearchserviceiface
Package elasticsearchserviceiface provides an interface to enable mocking the Amazon Elasticsearch Service service client for testing your code.
 Package elasticsearchserviceiface provides an interface to enable mocking the Amazon Elasticsearch Service service client for testing your code.
elastictranscoder
Package elastictranscoder provides the client and types for making API requests to Amazon Elastic Transcoder.
 Package elastictranscoder provides the client and types for making API requests to Amazon Elastic Transcoder.
elastictranscoder/elastictranscoderiface
Package elastictranscoderiface provides an interface to enable mocking the Amazon Elastic Transcoder service client for testing your code.
 Package elastictranscoderiface provides an interface to enable mocking the Amazon Elastic Transcoder service client for testing your code.
emr
Package emr provides the client and types for making API requests to Amazon EMR.
 Package emr provides the client and types for making API requests to Amazon EMR.
emr/emriface
Package emriface provides an interface to enable mocking the Amazon Elastic MapReduce service client for testing your code.
 Package emriface provides an interface to enable mocking the Amazon Elastic MapReduce service client for testing your code.
eventbridge
Package eventbridge provides the client and types for making API requests to Amazon EventBridge.
 Package eventbridge provides the client and types for making API requests to Amazon EventBridge.
eventbridge/eventbridgeiface
Package eventbridgeiface provides an interface to enable mocking the Amazon EventBridge service client for testing your code.
 Package eventbridgeiface provides an interface to enable mocking the Amazon EventBridge service client for testing your code.
firehose
Package firehose provides the client and types for making API requests to Firehose.
 Package firehose provides the client and types for making API requests to Firehose.
firehose/firehoseiface
Package firehoseiface provides an interface to enable mocking the Amazon Kinesis Firehose service client for testing your code.
 Package firehoseiface provides an interface to enable mocking the Amazon Kinesis Firehose service client for testing your code.
fms
Package fms provides the client and types for making API requests to FMS.
 Package fms provides the client and types for making API requests to FMS.
fms/fmsiface
Package fmsiface provides an interface to enable mocking the Firewall Management Service service client for testing your code.
 Package fmsiface provides an interface to enable mocking the Firewall Management Service service client for testing your code.
forecast
Package forecast provides the client and types for making API requests to Amazon Forecast Service.
 Package forecast provides the client and types for making API requests to Amazon Forecast Service.
forecast/forecastiface
Package forecastiface provides an interface to enable mocking the Amazon Forecast Service service client for testing your code.
 Package forecastiface provides an interface to enable mocking the Amazon Forecast Service service client for testing your code.
forecastquery
Package forecastquery provides the client and types for making API requests to Amazon Forecast Query Service.
 Package forecastquery provides the client and types for making API requests to Amazon Forecast Query Service.
forecastquery/forecastqueryiface
Package forecastqueryiface provides an interface to enable mocking the Amazon Forecast Query Service service client for testing your code.
 Package forecastqueryiface provides an interface to enable mocking the Amazon Forecast Query Service service client for testing your code.
frauddetector
Package frauddetector provides the client and types for making API requests to Amazon Fraud Detector.
 Package frauddetector provides the client and types for making API requests to Amazon Fraud Detector.
frauddetector/frauddetectoriface
Package frauddetectoriface provides an interface to enable mocking the Amazon Fraud Detector service client for testing your code.
 Package frauddetectoriface provides an interface to enable mocking the Amazon Fraud Detector service client for testing your code.
fsx
Package fsx provides the client and types for making API requests to Amazon FSx.
 Package fsx provides the client and types for making API requests to Amazon FSx.
fsx/fsxiface
Package fsxiface provides an interface to enable mocking the Amazon FSx service client for testing your code.
 Package fsxiface provides an interface to enable mocking the Amazon FSx service client for testing your code.
gamelift
Package gamelift provides the client and types for making API requests to Amazon GameLift.
 Package gamelift provides the client and types for making API requests to Amazon GameLift.
gamelift/gameliftiface
Package gameliftiface provides an interface to enable mocking the Amazon GameLift service client for testing your code.
 Package gameliftiface provides an interface to enable mocking the Amazon GameLift service client for testing your code.
glacier
Package glacier provides the client and types for making API requests to Amazon Glacier.
 Package glacier provides the client and types for making API requests to Amazon Glacier.
glacier/glacieriface
Package glacieriface provides an interface to enable mocking the Amazon Glacier service client for testing your code.
 Package glacieriface provides an interface to enable mocking the Amazon Glacier service client for testing your code.
globalaccelerator
Package globalaccelerator provides the client and types for making API requests to AWS Global Accelerator.
 Package globalaccelerator provides the client and types for making API requests to AWS Global Accelerator.
globalaccelerator/globalacceleratoriface
Package globalacceleratoriface provides an interface to enable mocking the AWS Global Accelerator service client for testing your code.
 Package globalacceleratoriface provides an interface to enable mocking the AWS Global Accelerator service client for testing your code.
glue
Package glue provides the client and types for making API requests to AWS Glue.
 Package glue provides the client and types for making API requests to AWS Glue.
glue/glueiface
Package glueiface provides an interface to enable mocking the AWS Glue service client for testing your code.
 Package glueiface provides an interface to enable mocking the AWS Glue service client for testing your code.
greengrass
Package greengrass provides the client and types for making API requests to AWS Greengrass.
 Package greengrass provides the client and types for making API requests to AWS Greengrass.
greengrass/greengrassiface
Package greengrassiface provides an interface to enable mocking the AWS Greengrass service client for testing your code.
 Package greengrassiface provides an interface to enable mocking the AWS Greengrass service client for testing your code.
groundstation
Package groundstation provides the client and types for making API requests to AWS Ground Station.
 Package groundstation provides the client and types for making API requests to AWS Ground Station.
groundstation/groundstationiface
Package groundstationiface provides an interface to enable mocking the AWS Ground Station service client for testing your code.
 Package groundstationiface provides an interface to enable mocking the AWS Ground Station service client for testing your code.
guardduty
Package guardduty provides the client and types for making API requests to Amazon GuardDuty.
 Package guardduty provides the client and types for making API requests to Amazon GuardDuty.
guardduty/guarddutyiface
Package guarddutyiface provides an interface to enable mocking the Amazon GuardDuty service client for testing your code.
 Package guarddutyiface provides an interface to enable mocking the Amazon GuardDuty service client for testing your code.
health
Package health provides the client and types for making API requests to AWSHealth.
 Package health provides the client and types for making API requests to AWSHealth.
health/healthiface
Package healthiface provides an interface to enable mocking the AWS Health APIs and Notifications service client for testing your code.
 Package healthiface provides an interface to enable mocking the AWS Health APIs and Notifications service client for testing your code.
iam
Package iam provides the client and types for making API requests to IAM.
 Package iam provides the client and types for making API requests to IAM.
iam/iamiface
Package iamiface provides an interface to enable mocking the AWS Identity and Access Management service client for testing your code.
 Package iamiface provides an interface to enable mocking the AWS Identity and Access Management service client for testing your code.
imagebuilder
Package imagebuilder provides the client and types for making API requests to imagebuilder.
 Package imagebuilder provides the client and types for making API requests to imagebuilder.
imagebuilder/imagebuilderiface
Package imagebuilderiface provides an interface to enable mocking the EC2 Image Builder service client for testing your code.
 Package imagebuilderiface provides an interface to enable mocking the EC2 Image Builder service client for testing your code.
inspector
Package inspector provides the client and types for making API requests to Amazon Inspector.
 Package inspector provides the client and types for making API requests to Amazon Inspector.
inspector/inspectoriface
Package inspectoriface provides an interface to enable mocking the Amazon Inspector service client for testing your code.
 Package inspectoriface provides an interface to enable mocking the Amazon Inspector service client for testing your code.
iot
Package iot provides the client and types for making API requests to AWS IoT. AWS IoT provides secure, bi-directional communication between Internet-connected devices (such as sensors, actuators, embedded devices, or smart appliances) and the AWS cloud.
 Package iot provides the client and types for making API requests to AWS IoT. AWS IoT provides secure, bi-directional communication between Internet-connected devices (such as sensors, actuators, embedded devices, or smart appliances) and the AWS cloud.
iot/iotiface
Package iotiface provides an interface to enable mocking the AWS IoT service client for testing your code.
 Package iotiface provides an interface to enable mocking the AWS IoT service client for testing your code.
iot1clickdevicesservice
Package iot1clickdevicesservice provides the client and types for making API requests to AWS IoT 1-Click Devices Service.
 Package iot1clickdevicesservice provides the client and types for making API requests to AWS IoT 1-Click Devices Service.
iot1clickdevicesservice/iot1clickdevicesserviceiface
Package iot1clickdevicesserviceiface provides an interface to enable mocking the AWS IoT 1-Click Devices Service service client for testing your code.
 Package iot1clickdevicesserviceiface provides an interface to enable mocking the AWS IoT 1-Click Devices Service service client for testing your code.
iot1clickprojects
Package iot1clickprojects provides the client and types for making API requests to AWS IoT 1-Click Projects.
 Package iot1clickprojects provides the client and types for making API requests to AWS IoT 1-Click Projects.
iot1clickprojects/iot1clickprojectsiface
Package iot1clickprojectsiface provides an interface to enable mocking the AWS IoT 1-Click Projects Service service client for testing your code.
 Package iot1clickprojectsiface provides an interface to enable mocking the AWS IoT 1-Click Projects Service service client for testing your code.
iotanalytics
Package iotanalytics provides the client and types for making API requests to AWS IoT Analytics.
 Package iotanalytics provides the client and types for making API requests to AWS IoT Analytics.
iotanalytics/iotanalyticsiface
Package iotanalyticsiface provides an interface to enable mocking the AWS IoT Analytics service client for testing your code.
 Package iotanalyticsiface provides an interface to enable mocking the AWS IoT Analytics service client for testing your code.
iotdataplane
Package iotdataplane provides the client and types for making API requests to AWS IoT Data Plane.
 Package iotdataplane provides the client and types for making API requests to AWS IoT Data Plane.
iotdataplane/iotdataplaneiface
Package iotdataplaneiface provides an interface to enable mocking the AWS IoT Data Plane service client for testing your code.
 Package iotdataplaneiface provides an interface to enable mocking the AWS IoT Data Plane service client for testing your code.
iotevents
Package iotevents provides the client and types for making API requests to AWS IoT Events.
 Package iotevents provides the client and types for making API requests to AWS IoT Events.
iotevents/ioteventsiface
Package ioteventsiface provides an interface to enable mocking the AWS IoT Events service client for testing your code.
 Package ioteventsiface provides an interface to enable mocking the AWS IoT Events service client for testing your code.
ioteventsdata
Package ioteventsdata provides the client and types for making API requests to AWS IoT Events Data.
 Package ioteventsdata provides the client and types for making API requests to AWS IoT Events Data.
ioteventsdata/ioteventsdataiface
Package ioteventsdataiface provides an interface to enable mocking the AWS IoT Events Data service client for testing your code.
 Package ioteventsdataiface provides an interface to enable mocking the AWS IoT Events Data service client for testing your code.
iotjobsdataplane
Package iotjobsdataplane provides the client and types for making API requests to AWS IoT Jobs Data Plane.
 Package iotjobsdataplane provides the client and types for making API requests to AWS IoT Jobs Data Plane.
iotjobsdataplane/iotjobsdataplaneiface
Package iotjobsdataplaneiface provides an interface to enable mocking the AWS IoT Jobs Data Plane service client for testing your code.
 Package iotjobsdataplaneiface provides an interface to enable mocking the AWS IoT Jobs Data Plane service client for testing your code.
iotsecuretunneling
Package iotsecuretunneling provides the client and types for making API requests to AWS IoT Secure Tunneling.
 Package iotsecuretunneling provides the client and types for making API requests to AWS IoT Secure Tunneling.
iotsecuretunneling/iotsecuretunnelingiface
Package iotsecuretunnelingiface provides an interface to enable mocking the AWS IoT Secure Tunneling service client for testing your code.
 Package iotsecuretunnelingiface provides an interface to enable mocking the AWS IoT Secure Tunneling service client for testing your code.
iotthingsgraph
Package iotthingsgraph provides the client and types for making API requests to AWS IoT Things Graph.
 Package iotthingsgraph provides the client and types for making API requests to AWS IoT Things Graph.
iotthingsgraph/iotthingsgraphiface
Package iotthingsgraphiface provides an interface to enable mocking the AWS IoT Things Graph service client for testing your code.
 Package iotthingsgraphiface provides an interface to enable mocking the AWS IoT Things Graph service client for testing your code.
kafka
Package kafka provides the client and types for making API requests to Kafka.
 Package kafka provides the client and types for making API requests to Kafka.
kafka/kafkaiface
Package kafkaiface provides an interface to enable mocking the Managed Streaming for Kafka service client for testing your code.
 Package kafkaiface provides an interface to enable mocking the Managed Streaming for Kafka service client for testing your code.
kendra
Package kendra provides the client and types for making API requests to kendra.
 Package kendra provides the client and types for making API requests to kendra.
kendra/kendraiface
Package kendraiface provides an interface to enable mocking the AWSKendraFrontendService service client for testing your code.
 Package kendraiface provides an interface to enable mocking the AWSKendraFrontendService service client for testing your code.
kinesis
Package kinesis provides the client and types for making API requests to Kinesis.
 Package kinesis provides the client and types for making API requests to Kinesis.
kinesis/kinesisiface
Package kinesisiface provides an interface to enable mocking the Amazon Kinesis service client for testing your code.
 Package kinesisiface provides an interface to enable mocking the Amazon Kinesis service client for testing your code.
kinesisanalytics
Package kinesisanalytics provides the client and types for making API requests to Kinesis Analytics.
 Package kinesisanalytics provides the client and types for making API requests to Kinesis Analytics.
kinesisanalytics/kinesisanalyticsiface
Package kinesisanalyticsiface provides an interface to enable mocking the Amazon Kinesis Analytics service client for testing your code.
 Package kinesisanalyticsiface provides an interface to enable mocking the Amazon Kinesis Analytics service client for testing your code.
kinesisanalyticsv2
Package kinesisanalyticsv2 provides the client and types for making API requests to Kinesis Analytics V2.
 Package kinesisanalyticsv2 provides the client and types for making API requests to Kinesis Analytics V2.
kinesisanalyticsv2/kinesisanalyticsv2iface
Package kinesisanalyticsv2iface provides an interface to enable mocking the Amazon Kinesis Analytics service client for testing your code.
 Package kinesisanalyticsv2iface provides an interface to enable mocking the Amazon Kinesis Analytics service client for testing your code.
kinesisvideo
Package kinesisvideo provides the client and types for making API requests to Kinesis Video.
 Package kinesisvideo provides the client and types for making API requests to Kinesis Video.
kinesisvideo/kinesisvideoiface
Package kinesisvideoiface provides an interface to enable mocking the Amazon Kinesis Video Streams service client for testing your code.
 Package kinesisvideoiface provides an interface to enable mocking the Amazon Kinesis Video Streams service client for testing your code.
kinesisvideoarchivedmedia
Package kinesisvideoarchivedmedia provides the client and types for making API requests to Kinesis Video Archived Media.
 Package kinesisvideoarchivedmedia provides the client and types for making API requests to Kinesis Video Archived Media.
kinesisvideoarchivedmedia/kinesisvideoarchivedmediaiface
Package kinesisvideoarchivedmediaiface provides an interface to enable mocking the Amazon Kinesis Video Streams Archived Media service client for testing your code.
 Package kinesisvideoarchivedmediaiface provides an interface to enable mocking the Amazon Kinesis Video Streams Archived Media service client for testing your code.
kinesisvideomedia
Package kinesisvideomedia provides the client and types for making API requests to Kinesis Video Media.
 Package kinesisvideomedia provides the client and types for making API requests to Kinesis Video Media.
kinesisvideomedia/kinesisvideomediaiface
Package kinesisvideomediaiface provides an interface to enable mocking the Amazon Kinesis Video Streams Media service client for testing your code.
 Package kinesisvideomediaiface provides an interface to enable mocking the Amazon Kinesis Video Streams Media service client for testing your code.
kinesisvideosignaling
Package kinesisvideosignaling provides the client and types for making API requests to Amazon Kinesis Video Signaling Channels.
 Package kinesisvideosignaling provides the client and types for making API requests to Amazon Kinesis Video Signaling Channels.
kinesisvideosignaling/kinesisvideosignalingiface
Package kinesisvideosignalingiface provides an interface to enable mocking the Amazon Kinesis Video Signaling Channels service client for testing your code.
 Package kinesisvideosignalingiface provides an interface to enable mocking the Amazon Kinesis Video Signaling Channels service client for testing your code.
kms
Package kms provides the client and types for making API requests to KMS.
 Package kms provides the client and types for making API requests to KMS.
kms/kmsiface
Package kmsiface provides an interface to enable mocking the AWS Key Management Service service client for testing your code.
 Package kmsiface provides an interface to enable mocking the AWS Key Management Service service client for testing your code.
lakeformation
Package lakeformation provides the client and types for making API requests to AWS Lake Formation.
 Package lakeformation provides the client and types for making API requests to AWS Lake Formation.
lakeformation/lakeformationiface
Package lakeformationiface provides an interface to enable mocking the AWS Lake Formation service client for testing your code.
 Package lakeformationiface provides an interface to enable mocking the AWS Lake Formation service client for testing your code.
lambda
Package lambda provides the client and types for making API requests to AWS Lambda.
 Package lambda provides the client and types for making API requests to AWS Lambda.
lambda/lambdaiface
Package lambdaiface provides an interface to enable mocking the AWS Lambda service client for testing your code.
 Package lambdaiface provides an interface to enable mocking the AWS Lambda service client for testing your code.
lexmodelbuildingservice
Package lexmodelbuildingservice provides the client and types for making API requests to Amazon Lex Model Building Service.
 Package lexmodelbuildingservice provides the client and types for making API requests to Amazon Lex Model Building Service.
lexmodelbuildingservice/lexmodelbuildingserviceiface
Package lexmodelbuildingserviceiface provides an interface to enable mocking the Amazon Lex Model Building Service service client for testing your code.
 Package lexmodelbuildingserviceiface provides an interface to enable mocking the Amazon Lex Model Building Service service client for testing your code.
lexruntimeservice
Package lexruntimeservice provides the client and types for making API requests to Amazon Lex Runtime Service.
 Package lexruntimeservice provides the client and types for making API requests to Amazon Lex Runtime Service.
lexruntimeservice/lexruntimeserviceiface
Package lexruntimeserviceiface provides an interface to enable mocking the Amazon Lex Runtime Service service client for testing your code.
 Package lexruntimeserviceiface provides an interface to enable mocking the Amazon Lex Runtime Service service client for testing your code.
licensemanager
Package licensemanager provides the client and types for making API requests to AWS License Manager.
 Package licensemanager provides the client and types for making API requests to AWS License Manager.
licensemanager/licensemanageriface
Package licensemanageriface provides an interface to enable mocking the AWS License Manager service client for testing your code.
 Package licensemanageriface provides an interface to enable mocking the AWS License Manager service client for testing your code.
lightsail
Package lightsail provides the client and types for making API requests to Amazon Lightsail.
 Package lightsail provides the client and types for making API requests to Amazon Lightsail.
lightsail/lightsailiface
Package lightsailiface provides an interface to enable mocking the Amazon Lightsail service client for testing your code.
 Package lightsailiface provides an interface to enable mocking the Amazon Lightsail service client for testing your code.
machinelearning
Package machinelearning provides the client and types for making API requests to Amazon Machine Learning.
 Package machinelearning provides the client and types for making API requests to Amazon Machine Learning.
machinelearning/machinelearningiface
Package machinelearningiface provides an interface to enable mocking the Amazon Machine Learning service client for testing your code.
 Package machinelearningiface provides an interface to enable mocking the Amazon Machine Learning service client for testing your code.
macie
Package macie provides the client and types for making API requests to Amazon Macie.
 Package macie provides the client and types for making API requests to Amazon Macie.
macie/macieiface
Package macieiface provides an interface to enable mocking the Amazon Macie service client for testing your code.
 Package macieiface provides an interface to enable mocking the Amazon Macie service client for testing your code.
managedblockchain
Package managedblockchain provides the client and types for making API requests to ManagedBlockchain.
 Package managedblockchain provides the client and types for making API requests to ManagedBlockchain.
managedblockchain/managedblockchainiface
Package managedblockchainiface provides an interface to enable mocking the Amazon Managed Blockchain service client for testing your code.
 Package managedblockchainiface provides an interface to enable mocking the Amazon Managed Blockchain service client for testing your code.
marketplacecatalog
Package marketplacecatalog provides the client and types for making API requests to AWS Marketplace Catalog.
 Package marketplacecatalog provides the client and types for making API requests to AWS Marketplace Catalog.
marketplacecatalog/marketplacecatalogiface
Package marketplacecatalogiface provides an interface to enable mocking the AWS Marketplace Catalog Service service client for testing your code.
 Package marketplacecatalogiface provides an interface to enable mocking the AWS Marketplace Catalog Service service client for testing your code.
marketplacecommerceanalytics
Package marketplacecommerceanalytics provides the client and types for making API requests to AWS Marketplace Commerce Analytics.
 Package marketplacecommerceanalytics provides the client and types for making API requests to AWS Marketplace Commerce Analytics.
marketplacecommerceanalytics/marketplacecommerceanalyticsiface
Package marketplacecommerceanalyticsiface provides an interface to enable mocking the AWS Marketplace Commerce Analytics service client for testing your code.
 Package marketplacecommerceanalyticsiface provides an interface to enable mocking the AWS Marketplace Commerce Analytics service client for testing your code.
marketplaceentitlementservice
Package marketplaceentitlementservice provides the client and types for making API requests to AWS Marketplace Entitlement Service.
 Package marketplaceentitlementservice provides the client and types for making API requests to AWS Marketplace Entitlement Service.
marketplaceentitlementservice/marketplaceentitlementserviceiface
Package marketplaceentitlementserviceiface provides an interface to enable mocking the AWS Marketplace Entitlement Service service client for testing your code.
 Package marketplaceentitlementserviceiface provides an interface to enable mocking the AWS Marketplace Entitlement Service service client for testing your code.
marketplacemetering
Package marketplacemetering provides the client and types for making API requests to AWSMarketplace Metering.
 Package marketplacemetering provides the client and types for making API requests to AWSMarketplace Metering.
marketplacemetering/marketplacemeteringiface
Package marketplacemeteringiface provides an interface to enable mocking the AWSMarketplace Metering service client for testing your code.
 Package marketplacemeteringiface provides an interface to enable mocking the AWSMarketplace Metering service client for testing your code.
mediaconnect
Package mediaconnect provides the client and types for making API requests to AWS MediaConnect.
 Package mediaconnect provides the client and types for making API requests to AWS MediaConnect.
mediaconnect/mediaconnectiface
Package mediaconnectiface provides an interface to enable mocking the AWS MediaConnect service client for testing your code.
 Package mediaconnectiface provides an interface to enable mocking the AWS MediaConnect service client for testing your code.
mediaconvert
Package mediaconvert provides the client and types for making API requests to MediaConvert.
 Package mediaconvert provides the client and types for making API requests to MediaConvert.
mediaconvert/mediaconvertiface
Package mediaconvertiface provides an interface to enable mocking the AWS Elemental MediaConvert service client for testing your code.
 Package mediaconvertiface provides an interface to enable mocking the AWS Elemental MediaConvert service client for testing your code.
medialive
Package medialive provides the client and types for making API requests to MediaLive.
 Package medialive provides the client and types for making API requests to MediaLive.
medialive/medialiveiface
Package medialiveiface provides an interface to enable mocking the AWS Elemental MediaLive service client for testing your code.
 Package medialiveiface provides an interface to enable mocking the AWS Elemental MediaLive service client for testing your code.
mediapackage
Package mediapackage provides the client and types for making API requests to MediaPackage.
 Package mediapackage provides the client and types for making API requests to MediaPackage.
mediapackage/mediapackageiface
Package mediapackageiface provides an interface to enable mocking the AWS Elemental MediaPackage service client for testing your code.
 Package mediapackageiface provides an interface to enable mocking the AWS Elemental MediaPackage service client for testing your code.
mediapackagevod
Package mediapackagevod provides the client and types for making API requests to MediaPackage Vod.
 Package mediapackagevod provides the client and types for making API requests to MediaPackage Vod.
mediapackagevod/mediapackagevodiface
Package mediapackagevodiface provides an interface to enable mocking the AWS Elemental MediaPackage VOD service client for testing your code.
 Package mediapackagevodiface provides an interface to enable mocking the AWS Elemental MediaPackage VOD service client for testing your code.
mediastore
Package mediastore provides the client and types for making API requests to MediaStore.
 Package mediastore provides the client and types for making API requests to MediaStore.
mediastore/mediastoreiface
Package mediastoreiface provides an interface to enable mocking the AWS Elemental MediaStore service client for testing your code.
 Package mediastoreiface provides an interface to enable mocking the AWS Elemental MediaStore service client for testing your code.
mediastoredata
Package mediastoredata provides the client and types for making API requests to MediaStore Data.
 Package mediastoredata provides the client and types for making API requests to MediaStore Data.
mediastoredata/mediastoredataiface
Package mediastoredataiface provides an interface to enable mocking the AWS Elemental MediaStore Data Plane service client for testing your code.
 Package mediastoredataiface provides an interface to enable mocking the AWS Elemental MediaStore Data Plane service client for testing your code.
mediatailor
Package mediatailor provides the client and types for making API requests to MediaTailor.
 Package mediatailor provides the client and types for making API requests to MediaTailor.
mediatailor/mediatailoriface
Package mediatailoriface provides an interface to enable mocking the AWS MediaTailor service client for testing your code.
 Package mediatailoriface provides an interface to enable mocking the AWS MediaTailor service client for testing your code.
migrationhub
Package migrationhub provides the client and types for making API requests to AWS Migration Hub.
 Package migrationhub provides the client and types for making API requests to AWS Migration Hub.
migrationhub/migrationhubiface
Package migrationhubiface provides an interface to enable mocking the AWS Migration Hub service client for testing your code.
 Package migrationhubiface provides an interface to enable mocking the AWS Migration Hub service client for testing your code.
migrationhubconfig
Package migrationhubconfig provides the client and types for making API requests to AWS Migration Hub Config.
 Package migrationhubconfig provides the client and types for making API requests to AWS Migration Hub Config.
migrationhubconfig/migrationhubconfigiface
Package migrationhubconfigiface provides an interface to enable mocking the AWS Migration Hub Config service client for testing your code.
 Package migrationhubconfigiface provides an interface to enable mocking the AWS Migration Hub Config service client for testing your code.
mobile
Package mobile provides the client and types for making API requests to AWS Mobile.
 Package mobile provides the client and types for making API requests to AWS Mobile.
mobile/mobileiface
Package mobileiface provides an interface to enable mocking the AWS Mobile service client for testing your code.
 Package mobileiface provides an interface to enable mocking the AWS Mobile service client for testing your code.
mobileanalytics
Package mobileanalytics provides the client and types for making API requests to Amazon Mobile Analytics.
 Package mobileanalytics provides the client and types for making API requests to Amazon Mobile Analytics.
mobileanalytics/mobileanalyticsiface
Package mobileanalyticsiface provides an interface to enable mocking the Amazon Mobile Analytics service client for testing your code.
 Package mobileanalyticsiface provides an interface to enable mocking the Amazon Mobile Analytics service client for testing your code.
mq
Package mq provides the client and types for making API requests to AmazonMQ.
 Package mq provides the client and types for making API requests to AmazonMQ.
mq/mqiface
Package mqiface provides an interface to enable mocking the AmazonMQ service client for testing your code.
 Package mqiface provides an interface to enable mocking the AmazonMQ service client for testing your code.
mturk
Package mturk provides the client and types for making API requests to Amazon MTurk.
 Package mturk provides the client and types for making API requests to Amazon MTurk.
mturk/mturkiface
Package mturkiface provides an interface to enable mocking the Amazon Mechanical Turk service client for testing your code.
 Package mturkiface provides an interface to enable mocking the Amazon Mechanical Turk service client for testing your code.
neptune
Package neptune provides the client and types for making API requests to Amazon Neptune.
 Package neptune provides the client and types for making API requests to Amazon Neptune.
neptune/neptuneiface
Package neptuneiface provides an interface to enable mocking the Amazon Neptune service client for testing your code.
 Package neptuneiface provides an interface to enable mocking the Amazon Neptune service client for testing your code.
networkmanager
Package networkmanager provides the client and types for making API requests to NetworkManager.
 Package networkmanager provides the client and types for making API requests to NetworkManager.
networkmanager/networkmanageriface
Package networkmanageriface provides an interface to enable mocking the AWS Network Manager service client for testing your code.
 Package networkmanageriface provides an interface to enable mocking the AWS Network Manager service client for testing your code.
opsworks
Package opsworks provides the client and types for making API requests to AWS OpsWorks.
 Package opsworks provides the client and types for making API requests to AWS OpsWorks.
opsworks/opsworksiface
Package opsworksiface provides an interface to enable mocking the AWS OpsWorks service client for testing your code.
 Package opsworksiface provides an interface to enable mocking the AWS OpsWorks service client for testing your code.
opsworkscm
Package opsworkscm provides the client and types for making API requests to OpsWorksCM.
 Package opsworkscm provides the client and types for making API requests to OpsWorksCM.
opsworkscm/opsworkscmiface
Package opsworkscmiface provides an interface to enable mocking the AWS OpsWorks CM service client for testing your code.
 Package opsworkscmiface provides an interface to enable mocking the AWS OpsWorks CM service client for testing your code.
organizations
Package organizations provides the client and types for making API requests to Organizations.
 Package organizations provides the client and types for making API requests to Organizations.
organizations/organizationsiface
Package organizationsiface provides an interface to enable mocking the AWS Organizations service client for testing your code.
 Package organizationsiface provides an interface to enable mocking the AWS Organizations service client for testing your code.
outposts
Package outposts provides the client and types for making API requests to Outposts.
 Package outposts provides the client and types for making API requests to Outposts.
outposts/outpostsiface
Package outpostsiface provides an interface to enable mocking the AWS Outposts service client for testing your code.
 Package outpostsiface provides an interface to enable mocking the AWS Outposts service client for testing your code.
personalize
Package personalize provides the client and types for making API requests to Amazon Personalize.
 Package personalize provides the client and types for making API requests to Amazon Personalize.
personalize/personalizeiface
Package personalizeiface provides an interface to enable mocking the Amazon Personalize service client for testing your code.
 Package personalizeiface provides an interface to enable mocking the Amazon Personalize service client for testing your code.
personalizeevents
Package personalizeevents provides the client and types for making API requests to Amazon Personalize Events.
 Package personalizeevents provides the client and types for making API requests to Amazon Personalize Events.
personalizeevents/personalizeeventsiface
Package personalizeeventsiface provides an interface to enable mocking the Amazon Personalize Events service client for testing your code.
 Package personalizeeventsiface provides an interface to enable mocking the Amazon Personalize Events service client for testing your code.
personalizeruntime
Package personalizeruntime provides the client and types for making API requests to Amazon Personalize Runtime.
 Package personalizeruntime provides the client and types for making API requests to Amazon Personalize Runtime.
personalizeruntime/personalizeruntimeiface
Package personalizeruntimeiface provides an interface to enable mocking the Amazon Personalize Runtime service client for testing your code.
 Package personalizeruntimeiface provides an interface to enable mocking the Amazon Personalize Runtime service client for testing your code.
pi
Package pi provides the client and types for making API requests to AWS PI.
 Package pi provides the client and types for making API requests to AWS PI.
pi/piiface
Package piiface provides an interface to enable mocking the AWS Performance Insights service client for testing your code.
 Package piiface provides an interface to enable mocking the AWS Performance Insights service client for testing your code.
pinpoint
Package pinpoint provides the client and types for making API requests to Amazon Pinpoint.
 Package pinpoint provides the client and types for making API requests to Amazon Pinpoint.
pinpoint/pinpointiface
Package pinpointiface provides an interface to enable mocking the Amazon Pinpoint service client for testing your code.
 Package pinpointiface provides an interface to enable mocking the Amazon Pinpoint service client for testing your code.
pinpointemail
Package pinpointemail provides the client and types for making API requests to Pinpoint Email.
 Package pinpointemail provides the client and types for making API requests to Pinpoint Email.
pinpointemail/pinpointemailiface
Package pinpointemailiface provides an interface to enable mocking the Amazon Pinpoint Email Service service client for testing your code.
 Package pinpointemailiface provides an interface to enable mocking the Amazon Pinpoint Email Service service client for testing your code.
pinpointsmsvoice
Package pinpointsmsvoice provides the client and types for making API requests to Pinpoint SMS Voice.
 Package pinpointsmsvoice provides the client and types for making API requests to Pinpoint SMS Voice.
pinpointsmsvoice/pinpointsmsvoiceiface
Package pinpointsmsvoiceiface provides an interface to enable mocking the Amazon Pinpoint SMS and Voice Service service client for testing your code.
 Package pinpointsmsvoiceiface provides an interface to enable mocking the Amazon Pinpoint SMS and Voice Service service client for testing your code.
polly
Package polly provides the client and types for making API requests to Amazon Polly.
 Package polly provides the client and types for making API requests to Amazon Polly.
polly/pollyiface
Package pollyiface provides an interface to enable mocking the Amazon Polly service client for testing your code.
 Package pollyiface provides an interface to enable mocking the Amazon Polly service client for testing your code.
pricing
Package pricing provides the client and types for making API requests to AWS Pricing.
 Package pricing provides the client and types for making API requests to AWS Pricing.
pricing/pricingiface
Package pricingiface provides an interface to enable mocking the AWS Price List Service service client for testing your code.
 Package pricingiface provides an interface to enable mocking the AWS Price List Service service client for testing your code.
qldb
Package qldb provides the client and types for making API requests to QLDB.
 Package qldb provides the client and types for making API requests to QLDB.
qldb/qldbiface
Package qldbiface provides an interface to enable mocking the Amazon QLDB service client for testing your code.
 Package qldbiface provides an interface to enable mocking the Amazon QLDB service client for testing your code.
qldbsession
Package qldbsession provides the client and types for making API requests to QLDB Session.
 Package qldbsession provides the client and types for making API requests to QLDB Session.
qldbsession/qldbsessioniface
Package qldbsessioniface provides an interface to enable mocking the Amazon QLDB Session service client for testing your code.
 Package qldbsessioniface provides an interface to enable mocking the Amazon QLDB Session service client for testing your code.
quicksight
Package quicksight provides the client and types for making API requests to Amazon QuickSight.
 Package quicksight provides the client and types for making API requests to Amazon QuickSight.
quicksight/quicksightiface
Package quicksightiface provides an interface to enable mocking the Amazon QuickSight service client for testing your code.
 Package quicksightiface provides an interface to enable mocking the Amazon QuickSight service client for testing your code.
ram
Package ram provides the client and types for making API requests to RAM.
 Package ram provides the client and types for making API requests to RAM.
ram/ramiface
Package ramiface provides an interface to enable mocking the AWS Resource Access Manager service client for testing your code.
 Package ramiface provides an interface to enable mocking the AWS Resource Access Manager service client for testing your code.
rds
Package rds provides the client and types for making API requests to Amazon RDS.
 Package rds provides the client and types for making API requests to Amazon RDS.
rds/rdsiface
Package rdsiface provides an interface to enable mocking the Amazon Relational Database Service service client for testing your code.
 Package rdsiface provides an interface to enable mocking the Amazon Relational Database Service service client for testing your code.
rds/rdsutils
Package rdsutils is used to generate authentication tokens used to connect to a givent Amazon Relational Database Service (RDS) database.
 Package rdsutils is used to generate authentication tokens used to connect to a givent Amazon Relational Database Service (RDS) database.
rdsdata
Package rdsdata provides the client and types for making API requests to AWS RDS DataService.
 Package rdsdata provides the client and types for making API requests to AWS RDS DataService.
rdsdata/rdsdataiface
Package rdsdataiface provides an interface to enable mocking the AWS RDS DataService service client for testing your code.
 Package rdsdataiface provides an interface to enable mocking the AWS RDS DataService service client for testing your code.
redshift
Package redshift provides the client and types for making API requests to Amazon Redshift.
 Package redshift provides the client and types for making API requests to Amazon Redshift.
redshift/redshiftiface
Package redshiftiface provides an interface to enable mocking the Amazon Redshift service client for testing your code.
 Package redshiftiface provides an interface to enable mocking the Amazon Redshift service client for testing your code.
rekognition
Package rekognition provides the client and types for making API requests to Amazon Rekognition.
 Package rekognition provides the client and types for making API requests to Amazon Rekognition.
rekognition/rekognitioniface
Package rekognitioniface provides an interface to enable mocking the Amazon Rekognition service client for testing your code.
 Package rekognitioniface provides an interface to enable mocking the Amazon Rekognition service client for testing your code.
resourcegroups
Package resourcegroups provides the client and types for making API requests to Resource Groups.
 Package resourcegroups provides the client and types for making API requests to Resource Groups.
resourcegroups/resourcegroupsiface
Package resourcegroupsiface provides an interface to enable mocking the AWS Resource Groups service client for testing your code.
 Package resourcegroupsiface provides an interface to enable mocking the AWS Resource Groups service client for testing your code.
resourcegroupstaggingapi
Package resourcegroupstaggingapi provides the client and types for making API requests to AWS Resource Groups Tagging API.
 Package resourcegroupstaggingapi provides the client and types for making API requests to AWS Resource Groups Tagging API.
resourcegroupstaggingapi/resourcegroupstaggingapiiface
Package resourcegroupstaggingapiiface provides an interface to enable mocking the AWS Resource Groups Tagging API service client for testing your code.
 Package resourcegroupstaggingapiiface provides an interface to enable mocking the AWS Resource Groups Tagging API service client for testing your code.
robomaker
Package robomaker provides the client and types for making API requests to RoboMaker.
 Package robomaker provides the client and types for making API requests to RoboMaker.
robomaker/robomakeriface
Package robomakeriface provides an interface to enable mocking the AWS RoboMaker service client for testing your code.
 Package robomakeriface provides an interface to enable mocking the AWS RoboMaker service client for testing your code.
route53
Package route53 provides the client and types for making API requests to Route 53.
 Package route53 provides the client and types for making API requests to Route 53.
route53/route53iface
Package route53iface provides an interface to enable mocking the Amazon Route 53 service client for testing your code.
 Package route53iface provides an interface to enable mocking the Amazon Route 53 service client for testing your code.
route53domains
Package route53domains provides the client and types for making API requests to Amazon Route 53 Domains.
 Package route53domains provides the client and types for making API requests to Amazon Route 53 Domains.
route53domains/route53domainsiface
Package route53domainsiface provides an interface to enable mocking the Amazon Route 53 Domains service client for testing your code.
 Package route53domainsiface provides an interface to enable mocking the Amazon Route 53 Domains service client for testing your code.
route53resolver
Package route53resolver provides the client and types for making API requests to Route53Resolver.
 Package route53resolver provides the client and types for making API requests to Route53Resolver.
route53resolver/route53resolveriface
Package route53resolveriface provides an interface to enable mocking the Amazon Route 53 Resolver service client for testing your code.
 Package route53resolveriface provides an interface to enable mocking the Amazon Route 53 Resolver service client for testing your code.
s3
Package s3 provides the client and types for making API requests to Amazon S3.
 Package s3 provides the client and types for making API requests to Amazon S3.
s3/s3crypto
Package s3crypto is deprecated and may be removed from the future versions of the SDK.
 Package s3crypto is deprecated and may be removed from the future versions of the SDK.
s3/s3iface
Package s3iface provides an interface to enable mocking the Amazon Simple Storage Service service client for testing your code.
 Package s3iface provides an interface to enable mocking the Amazon Simple Storage Service service client for testing your code.
s3/s3manager
Package s3manager provides utilities to upload and download objects from S3 concurrently.
 Package s3manager provides utilities to upload and download objects from S3 concurrently.
s3/s3manager/s3manageriface
Package s3manageriface provides an interface for the s3manager package
 Package s3manageriface provides an interface for the s3manager package
s3control
Package s3control provides the client and types for making API requests to AWS S3 Control.
 Package s3control provides the client and types for making API requests to AWS S3 Control.
s3control/s3controliface
Package s3controliface provides an interface to enable mocking the AWS S3 Control service client for testing your code.
 Package s3controliface provides an interface to enable mocking the AWS S3 Control service client for testing your code.
sagemaker
Package sagemaker provides the client and types for making API requests to SageMaker.
 Package sagemaker provides the client and types for making API requests to SageMaker.
sagemaker/sagemakeriface
Package sagemakeriface provides an interface to enable mocking the Amazon SageMaker Service service client for testing your code.
 Package sagemakeriface provides an interface to enable mocking the Amazon SageMaker Service service client for testing your code.
sagemakera2iruntime
Package sagemakera2iruntime provides the client and types for making API requests to Amazon Augmented AI Runtime.
 Package sagemakera2iruntime provides the client and types for making API requests to Amazon Augmented AI Runtime.
sagemakera2iruntime/sagemakera2iruntimeiface
Package sagemakera2iruntimeiface provides an interface to enable mocking the Amazon Augmented AI Runtime service client for testing your code.
 Package sagemakera2iruntimeiface provides an interface to enable mocking the Amazon Augmented AI Runtime service client for testing your code.
sagemakerruntime
Package sagemakerruntime provides the client and types for making API requests to Amazon SageMaker Runtime.
 Package sagemakerruntime provides the client and types for making API requests to Amazon SageMaker Runtime.
sagemakerruntime/sagemakerruntimeiface
Package sagemakerruntimeiface provides an interface to enable mocking the Amazon SageMaker Runtime service client for testing your code.
 Package sagemakerruntimeiface provides an interface to enable mocking the Amazon SageMaker Runtime service client for testing your code.
savingsplans
Package savingsplans provides the client and types for making API requests to AWSSavingsPlans.
 Package savingsplans provides the client and types for making API requests to AWSSavingsPlans.
savingsplans/savingsplansiface
Package savingsplansiface provides an interface to enable mocking the AWS Savings Plans service client for testing your code.
 Package savingsplansiface provides an interface to enable mocking the AWS Savings Plans service client for testing your code.
schemas
Package schemas provides the client and types for making API requests to Schemas.
 Package schemas provides the client and types for making API requests to Schemas.
schemas/schemasiface
Package schemasiface provides an interface to enable mocking the Schemas service client for testing your code.
 Package schemasiface provides an interface to enable mocking the Schemas service client for testing your code.
secretsmanager
Package secretsmanager provides the client and types for making API requests to AWS Secrets Manager.
 Package secretsmanager provides the client and types for making API requests to AWS Secrets Manager.
secretsmanager/secretsmanageriface
Package secretsmanageriface provides an interface to enable mocking the AWS Secrets Manager service client for testing your code.
 Package secretsmanageriface provides an interface to enable mocking the AWS Secrets Manager service client for testing your code.
securityhub
Package securityhub provides the client and types for making API requests to AWS SecurityHub.
 Package securityhub provides the client and types for making API requests to AWS SecurityHub.
securityhub/securityhubiface
Package securityhubiface provides an interface to enable mocking the AWS SecurityHub service client for testing your code.
 Package securityhubiface provides an interface to enable mocking the AWS SecurityHub service client for testing your code.
serverlessapplicationrepository
Package serverlessapplicationrepository provides the client and types for making API requests to AWSServerlessApplicationRepository.
 Package serverlessapplicationrepository provides the client and types for making API requests to AWSServerlessApplicationRepository.
serverlessapplicationrepository/serverlessapplicationrepositoryiface
Package serverlessapplicationrepositoryiface provides an interface to enable mocking the AWSServerlessApplicationRepository service client for testing your code.
 Package serverlessapplicationrepositoryiface provides an interface to enable mocking the AWSServerlessApplicationRepository service client for testing your code.
servicecatalog
Package servicecatalog provides the client and types for making API requests to AWS Service Catalog.
 Package servicecatalog provides the client and types for making API requests to AWS Service Catalog.
servicecatalog/servicecatalogiface
Package servicecatalogiface provides an interface to enable mocking the AWS Service Catalog service client for testing your code.
 Package servicecatalogiface provides an interface to enable mocking the AWS Service Catalog service client for testing your code.
servicediscovery
Package servicediscovery provides the client and types for making API requests to ServiceDiscovery.
 Package servicediscovery provides the client and types for making API requests to ServiceDiscovery.
servicediscovery/servicediscoveryiface
Package servicediscoveryiface provides an interface to enable mocking the AWS Cloud Map service client for testing your code.
 Package servicediscoveryiface provides an interface to enable mocking the AWS Cloud Map service client for testing your code.
servicequotas
Package servicequotas provides the client and types for making API requests to Service Quotas.
 Package servicequotas provides the client and types for making API requests to Service Quotas.
servicequotas/servicequotasiface
Package servicequotasiface provides an interface to enable mocking the Service Quotas service client for testing your code.
 Package servicequotasiface provides an interface to enable mocking the Service Quotas service client for testing your code.
ses
Package ses provides the client and types for making API requests to Amazon SES.
 Package ses provides the client and types for making API requests to Amazon SES.
ses/sesiface
Package sesiface provides an interface to enable mocking the Amazon Simple Email Service service client for testing your code.
 Package sesiface provides an interface to enable mocking the Amazon Simple Email Service service client for testing your code.
sesv2
Package sesv2 provides the client and types for making API requests to Amazon SES V2.
 Package sesv2 provides the client and types for making API requests to Amazon SES V2.
sesv2/sesv2iface
Package sesv2iface provides an interface to enable mocking the Amazon Simple Email Service service client for testing your code.
 Package sesv2iface provides an interface to enable mocking the Amazon Simple Email Service service client for testing your code.
sfn
Package sfn provides the client and types for making API requests to AWS SFN.
 Package sfn provides the client and types for making API requests to AWS SFN.
sfn/sfniface
Package sfniface provides an interface to enable mocking the AWS Step Functions service client for testing your code.
 Package sfniface provides an interface to enable mocking the AWS Step Functions service client for testing your code.
shield
Package shield provides the client and types for making API requests to AWS Shield.
 Package shield provides the client and types for making API requests to AWS Shield.
shield/shieldiface
Package shieldiface provides an interface to enable mocking the AWS Shield service client for testing your code.
 Package shieldiface provides an interface to enable mocking the AWS Shield service client for testing your code.
signer
Package signer provides the client and types for making API requests to signer.
 Package signer provides the client and types for making API requests to signer.
signer/signeriface
Package signeriface provides an interface to enable mocking the AWS Signer service client for testing your code.
 Package signeriface provides an interface to enable mocking the AWS Signer service client for testing your code.
simpledb
Package simpledb provides the client and types for making API requests to Amazon SimpleDB.
 Package simpledb provides the client and types for making API requests to Amazon SimpleDB.
simpledb/simpledbiface
Package simpledbiface provides an interface to enable mocking the Amazon SimpleDB service client for testing your code.
 Package simpledbiface provides an interface to enable mocking the Amazon SimpleDB service client for testing your code.
sms
Package sms provides the client and types for making API requests to SMS.
 Package sms provides the client and types for making API requests to SMS.
sms/smsiface
Package smsiface provides an interface to enable mocking the AWS Server Migration Service service client for testing your code.
 Package smsiface provides an interface to enable mocking the AWS Server Migration Service service client for testing your code.
snowball
Package snowball provides the client and types for making API requests to Amazon Snowball.
 Package snowball provides the client and types for making API requests to Amazon Snowball.
snowball/snowballiface
Package snowballiface provides an interface to enable mocking the Amazon Import/Export Snowball service client for testing your code.
 Package snowballiface provides an interface to enable mocking the Amazon Import/Export Snowball service client for testing your code.
sns
Package sns provides the client and types for making API requests to Amazon SNS.
 Package sns provides the client and types for making API requests to Amazon SNS.
sns/snsiface
Package snsiface provides an interface to enable mocking the Amazon Simple Notification Service service client for testing your code.
 Package snsiface provides an interface to enable mocking the Amazon Simple Notification Service service client for testing your code.
sqs
Package sqs provides the client and types for making API requests to Amazon SQS.
 Package sqs provides the client and types for making API requests to Amazon SQS.
sqs/sqsiface
Package sqsiface provides an interface to enable mocking the Amazon Simple Queue Service service client for testing your code.
 Package sqsiface provides an interface to enable mocking the Amazon Simple Queue Service service client for testing your code.
ssm
Package ssm provides the client and types for making API requests to Amazon SSM.
 Package ssm provides the client and types for making API requests to Amazon SSM.
ssm/ssmiface
Package ssmiface provides an interface to enable mocking the Amazon Simple Systems Manager (SSM) service client for testing your code.
 Package ssmiface provides an interface to enable mocking the Amazon Simple Systems Manager (SSM) service client for testing your code.
sso
Package sso provides the client and types for making API requests to SSO.
 Package sso provides the client and types for making API requests to SSO.
sso/ssoiface
Package ssoiface provides an interface to enable mocking the AWS Single Sign-On service client for testing your code.
 Package ssoiface provides an interface to enable mocking the AWS Single Sign-On service client for testing your code.
ssooidc
Package ssooidc provides the client and types for making API requests to SSO OIDC.
 Package ssooidc provides the client and types for making API requests to SSO OIDC.
ssooidc/ssooidciface
Package ssooidciface provides an interface to enable mocking the AWS SSO OIDC service client for testing your code.
 Package ssooidciface provides an interface to enable mocking the AWS SSO OIDC service client for testing your code.
storagegateway
Package storagegateway provides the client and types for making API requests to AWS Storage Gateway.
 Package storagegateway provides the client and types for making API requests to AWS Storage Gateway.
storagegateway/storagegatewayiface
Package storagegatewayiface provides an interface to enable mocking the AWS Storage Gateway service client for testing your code.
 Package storagegatewayiface provides an interface to enable mocking the AWS Storage Gateway service client for testing your code.
sts
Package sts provides the client and types for making API requests to AWS STS.
 Package sts provides the client and types for making API requests to AWS STS.
sts/stsiface
Package stsiface provides an interface to enable mocking the AWS Security Token Service service client for testing your code.
 Package stsiface provides an interface to enable mocking the AWS Security Token Service service client for testing your code.
support
Package support provides the client and types for making API requests to AWS Support.
 Package support provides the client and types for making API requests to AWS Support.
support/supportiface
Package supportiface provides an interface to enable mocking the AWS Support service client for testing your code.
 Package supportiface provides an interface to enable mocking the AWS Support service client for testing your code.
swf
Package swf provides the client and types for making API requests to Amazon SWF.
 Package swf provides the client and types for making API requests to Amazon SWF.
swf/swfiface
Package swfiface provides an interface to enable mocking the Amazon Simple Workflow Service service client for testing your code.
 Package swfiface provides an interface to enable mocking the Amazon Simple Workflow Service service client for testing your code.
textract
Package textract provides the client and types for making API requests to Amazon Textract.
 Package textract provides the client and types for making API requests to Amazon Textract.
textract/textractiface
Package textractiface provides an interface to enable mocking the Amazon Textract service client for testing your code.
 Package textractiface provides an interface to enable mocking the Amazon Textract service client for testing your code.
transcribe
Package transcribe provides the client and types for making API requests to Amazon Transcribe Service.
 Package transcribe provides the client and types for making API requests to Amazon Transcribe Service.
transcribe/transcribeiface
Package transcribeiface provides an interface to enable mocking the Amazon Transcribe Service service client for testing your code.
 Package transcribeiface provides an interface to enable mocking the Amazon Transcribe Service service client for testing your code.
transfer
Package transfer provides the client and types for making API requests to AWS Transfer.
 Package transfer provides the client and types for making API requests to AWS Transfer.
transfer/transferiface
Package transferiface provides an interface to enable mocking the AWS Transfer for SFTP service client for testing your code.
 Package transferiface provides an interface to enable mocking the AWS Transfer for SFTP service client for testing your code.
translate
Package translate provides the client and types for making API requests to Amazon Translate.
 Package translate provides the client and types for making API requests to Amazon Translate.
translate/translateiface
Package translateiface provides an interface to enable mocking the Amazon Translate service client for testing your code.
 Package translateiface provides an interface to enable mocking the Amazon Translate service client for testing your code.
waf
Package waf provides the client and types for making API requests to WAF.
 Package waf provides the client and types for making API requests to WAF.
waf/wafiface
Package wafiface provides an interface to enable mocking the AWS WAF service client for testing your code.
 Package wafiface provides an interface to enable mocking the AWS WAF service client for testing your code.
wafregional
Package wafregional provides the client and types for making API requests to WAF Regional.
 Package wafregional provides the client and types for making API requests to WAF Regional.
wafregional/wafregionaliface
Package wafregionaliface provides an interface to enable mocking the AWS WAF Regional service client for testing your code.
 Package wafregionaliface provides an interface to enable mocking the AWS WAF Regional service client for testing your code.
wafv2
Package wafv2 provides the client and types for making API requests to WAFV2.
 Package wafv2 provides the client and types for making API requests to WAFV2.
wafv2/wafv2iface
Package wafv2iface provides an interface to enable mocking the AWS WAFV2 service client for testing your code.
 Package wafv2iface provides an interface to enable mocking the AWS WAFV2 service client for testing your code.
workdocs
Package workdocs provides the client and types for making API requests to Amazon WorkDocs.
 Package workdocs provides the client and types for making API requests to Amazon WorkDocs.
workdocs/workdocsiface
Package workdocsiface provides an interface to enable mocking the Amazon WorkDocs service client for testing your code.
 Package workdocsiface provides an interface to enable mocking the Amazon WorkDocs service client for testing your code.
worklink
Package worklink provides the client and types for making API requests to WorkLink.
 Package worklink provides the client and types for making API requests to WorkLink.
worklink/worklinkiface
Package worklinkiface provides an interface to enable mocking the Amazon WorkLink service client for testing your code.
 Package worklinkiface provides an interface to enable mocking the Amazon WorkLink service client for testing your code.
workmail
Package workmail provides the client and types for making API requests to Amazon WorkMail.
 Package workmail provides the client and types for making API requests to Amazon WorkMail.
workmail/workmailiface
Package workmailiface provides an interface to enable mocking the Amazon WorkMail service client for testing your code.
 Package workmailiface provides an interface to enable mocking the Amazon WorkMail service client for testing your code.
workmailmessageflow
Package workmailmessageflow provides the client and types for making API requests to Amazon WorkMail Message Flow.
 Package workmailmessageflow provides the client and types for making API requests to Amazon WorkMail Message Flow.
workmailmessageflow/workmailmessageflowiface
Package workmailmessageflowiface provides an interface to enable mocking the Amazon WorkMail Message Flow service client for testing your code.
 Package workmailmessageflowiface provides an interface to enable mocking the Amazon WorkMail Message Flow service client for testing your code.
workspaces
Package workspaces provides the client and types for making API requests to Amazon WorkSpaces.
 Package workspaces provides the client and types for making API requests to Amazon WorkSpaces.
workspaces/workspacesiface
Package workspacesiface provides an interface to enable mocking the Amazon WorkSpaces service client for testing your code.
 Package workspacesiface provides an interface to enable mocking the Amazon WorkSpaces service client for testing your code.
xray
Package xray provides the client and types for making API requests to AWS X-Ray.
 Package xray provides the client and types for making API requests to AWS X-Ray.
xray/xrayiface
Package xrayiface provides an interface to enable mocking the AWS X-Ray service client for testing your code.
 Package xrayiface provides an interface to enable mocking the AWS X-Ray service client for testing your code.
account Module
amp Module
amplifybackend Module
amplifyuibuilder Module
appconfigdata Module
appfabric Module
appflow Module
appintegrations Module
applicationcostprofiler Module
apprunner Module
arczonalshift Module
artifact Module
auditmanager Module
b2bi Module
backupgateway Module
backupstorage Module
bcmdataexports Module
bedrock Module
bedrockagent Module
bedrockagentruntime Module
bedrockruntime Module
billingconductor Module
braket Module
chatbot Module
chimesdkidentity Module
chimesdkmediapipelines Module
chimesdkmeetings Module
chimesdkmessaging Module
chimesdkvoice Module
cleanrooms Module
cleanroomsml Module
cloudcontrol Module
cloudfrontkeyvaluestore Module
cloudtraildata Module
codeartifact Module
codecatalyst Module
codeconnections Module
codegurusecurity Module
codestarconnections Module
commander Module
connectcampaigns Module
connectcases Module
connectcontactlens Module
controlcatalog Module
controltower Module
costoptimizationhub Module
customerprofiles Module
databrew Module
datazone Module
deadline Module
detective Module
devopsguru Module
docdbelastic Module
drs Module
ecrpublic Module
eksauth Module
emrcontainers Module
emrserverless Module
entityresolution Module
evidently Module
finspace Module
finspacedata Module
fis Module
freetier Module
gamesparks Module
grafana Module
greengrassv2 Module
healthlake Module
honeycode Module
identitystore Module
inspector2 Module
inspectorscan Module
internal/accept-encoding Module
internal/benchmark Module
internal/checksum Module
internal/endpoint-discovery Module
internal/eventstreamtesting Module
internal/integrationtest Module
internal/presigned-url Module
internal/s3shared Module
internetmonitor Module
iotdeviceadvisor Module
iotfleethub Module
iotfleetwise Module
iotroborunner Module
iotsitewise Module
iottwinmaker Module
iotwireless Module
ivs Module
ivschat Module
ivsrealtime Module
kafkaconnect Module
kendraranking Module
keyspaces Module
kinesis/internal/testing Module
kinesisvideowebrtcstorage Module
launchwizard Module
lexmodelsv2 Module
lexruntimev2 Module
licensemanagerlinuxsubscriptions Module
licensemanagerusersubscriptions Module
location Module
lookoutequipment Module
lookoutmetrics Module
lookoutvision Module
m2 Module
macie2 Module
managedblockchainquery Module
marketplaceagreement Module
marketplacedeployment Module
mediapackagev2 Module
medicalimaging Module
memorydb Module
mgn Module
migrationhuborchestrator Module
migrationhubrefactorspaces Module
migrationhubstrategy Module
mwaa Module
neptunedata Module
neptunegraph Module
networkfirewall Module
networkmonitor Module
nimble Module
oam Module
omics Module
opensearch Module
opensearchserverless Module
osis Module
panorama Module
paymentcryptography Module
paymentcryptographydata Module
pcaconnectorad Module
pinpointsmsvoicev2 Module
pipes Module
privatenetworks Module
proton Module
qbusiness Module
qconnect Module
rbin Module
redshiftdata Module
redshiftserverless Module
repostspace Module
resiliencehub Module
resourceexplorer2 Module
rolesanywhere Module
route53profiles Module
route53recoverycluster Module
route53recoverycontrolconfig Module
route53recoveryreadiness Module
rum Module
s3/internal/configtesting Module
s3outposts Module
sagemakeredge Module
sagemakerfeaturestoreruntime Module
sagemakergeospatial Module
sagemakermetrics Module
scheduler Module
securitylake Module
servicecatalogappregistry Module
simspaceweaver Module
snowdevicemanagement Module
ssmcontacts Module
ssmincidents Module
ssmsap Module
ssoadmin Module
supplychain Module
supportapp Module
synthetics Module
timestreaminfluxdb Module
timestreamquery Module
timestreamwrite Module
tnb Module
transcribestreaming Module
transcribestreaming/internal/testing Module
trustedadvisor Module
verifiedpermissions Module
voiceid Module
vpclattice Module
wellarchitected Module
wisdom Module
workspacesthinclient Module
workspacesweb Module

Jump to

Keyboard shortcuts

? : This menu
/ : Search site
f or F : Jump to
y or Y : Canonical URL
go.dev uses cookies from Google to deliver and enhance the quality of its services and to analyze traffic. Learn more.