sdk

package module
v0.4.0 Latest Latest
Warning

This package is not in the latest version of its module.

Go to latest
Published: May 26, 2018 License: Apache-2.0 Imports: 0 Imported by: 0

README

Build Status Documentation

AWS SDK for Go v2

aws-sdk-go-v2 is the Developer Preview for the v2 of the AWS SDK for the Go programming language.

Check out the Issues and Projects for design and updates being made to the SDK. The v2 SDK requires a minimum version of Go 1.9.

We'll be expanding out the Issues and Projects sections with additional changes to the SDK based on your feedback, and SDK's core's improvements. Check the the SDK's CHANGE_LOG for information about the latest updates to the SDK.

Getting started

The best way to get started working with the SDK is to use go get to add the SDK to your Go Workspace manually.

go get github.com/aws/aws-sdk-go-v2

You could also use Dep to add the SDK to your application's dependencies. Using Dep will simplify your update story and help your application keep pinned to specific version of the SDK

dep ensure -add github.com/aws/aws-sdk-go-v2
Hello AWS

This example shows how you can use the v2 SDK to make an API request using the SDK's Amazon DynamoDB client.

package main

import (
	"github.com/aws/aws-sdk-go-v2/aws"
	"github.com/aws/aws-sdk-go-v2/aws/endpoints"
	"github.com/aws/aws-sdk-go-v2/aws/external"
	"github.com/aws/aws-sdk-go-v2/service/dynamodb"
)

func main() {
	// Using the SDK's default configuration, loading additional config
	// and credentials values from the environment variables, shared
	// credentials, and shared configuration files
	cfg, err := external.LoadDefaultAWSConfig()
	if err != nil {
		panic("unable to load SDK config, " + err.Error())
	}

	// Set the AWS Region that the service clients should use
	cfg.Region = endpoints.UsWest2RegionID

	// Using the Config value, create the DynamoDB client
	svc := dynamodb.New(cfg)

	// Build the request with its input parameters
	req := svc.DescribeTableRequest(&dynamodb.DescribeTableInput{
		TableName: aws.String("myTable"),
	})

	// Send the request, and get the response or error back
	resp, err := req.Send()
	if err != nil {
		panic("failed to describe table, "+err.Error())
	}

	fmt.Println("Response", resp)
}

Feedback and contributing

The v2 SDK will use [GitHub issues] to track feature requests and issues with the SDK. In addition, we'll use GitHub Projects to track large tasks spanning multiple pull requests, such as refactoring the SDK's internal request lifecycle. You can provide feedback to us in several ways.

GitHub issues. To provide feedback using GitHub Issues on the SDK. This is the preferred mechanism to give feedback so that other users can engage in the conversation, +1 issues, etc. Issues you open will be evaluated, and included in our roadmap for the GA launch.

Gitter channel. For more informal discussions or general feedback, check out our Gitter channel for the SDK. The Gitter channel is also a great place to ask general questions, and find help to get started with the 2.0 SDK Developer Preview.

Contributing. You can open pull requests for fixes or additions to the AWS SDK for Go 2.0 Developer Preview release. All pull requests must be submitted under the Apache 2.0 license and will be reviewed by an SDK team member before being merged in. Accompanying unit tests, where possible, are appreciated.

License

This SDK is distributed under the Apache License, Version 2.0, see LICENSE.txt and NOTICE.txt for more information.

Documentation

Overview

Package sdk is the official AWS SDK v2 for the Go programming language.

aws-sdk-go-v2 is the Developer Preview for the v2 of the AWS SDK for the Go programming language. Look for additional documentation and examples to be added.

Getting started

The best way to get started working with the SDK is to use `go get` to add the SDK to your Go Workspace manually.

go get github.com/aws/aws-sdk-go-v2

You could also use [Dep] to add the SDK to your application's dependencies. Using [Dep] will simplify your update story and help your application keep pinned to specific version of the SDK

dep ensure --add github.com/aws/aws-sdk-go-v2

### Hello AWS

This example shows how you can use the v2 SDK to make an API request using the SDK's Amazon DynamoDB client.

package main

import (
	"github.com/aws/aws-sdk-go-v2/aws"
	"github.com/aws/aws-sdk-go-v2/aws/endpoints"
	"github.com/aws/aws-sdk-go-v2/aws/external"
	"github.com/aws/aws-sdk-go-v2/service/dynamodb"
)

func main() {
	// Using the SDK's default configuration, loading additional config
	// and credentials values from the environment variables, shared
	// credentials, and shared configuration files
	cfg, err := external.LoadDefaultAWSConfig()
	if err != nil {
		panic("unable to load SDK config, " + err.Error())
	}

	// Set the AWS Region that the service clients should use
	cfg.Region = endpoints.UsWest2RegionID

	// Using the Config value, create the DynamoDB client
	svc := dynamodb.New(cfg)

	// Build the request with its input parameters
	req := svc.DescribeTableRequest(&dynamodb.DescribeTableInput{
		TableName: aws.String("myTable"),
	})

	// Send the request, and get the response or error back
	resp, err := req.Send()
	if err != nil {
		panic("failed to describe table, "+err.Error())
	}

	fmt.Println("Response", resp)
}

Directories

Path Synopsis
aws
Package aws provides the core SDK's utilities and shared types.
Package aws provides the core SDK's utilities and shared types.
arn
Package arn provides a parser for interacting with Amazon Resource Names.
Package arn provides a parser for interacting with Amazon Resource Names.
awserr
Package awserr represents API error interface accessors for the SDK.
Package awserr represents API error interface accessors for the SDK.
defaults
Package defaults is a collection of helpers to retrieve the SDK's default configuration and handlers.
Package defaults is a collection of helpers to retrieve the SDK's default configuration and handlers.
ec2metadata
Package ec2metadata provides the client for making API calls to the EC2 Metadata service.
Package ec2metadata provides the client for making API calls to the EC2 Metadata service.
endpointcreds
Package endpointcreds provides support for retrieving credentials from an arbitrary HTTP endpoint.
Package endpointcreds provides support for retrieving credentials from an arbitrary HTTP endpoint.
endpoints
Package endpoints provides the types and functionality for defining regions and endpoints, as well as querying those definitions.
Package endpoints provides the types and functionality for defining regions and endpoints, as well as querying those definitions.
plugincreds
Package plugincreds implements a credentials provider sourced from a Go plugin.
Package plugincreds implements a credentials provider sourced from a Go plugin.
signer/v4
Package v4 implements signing for AWS V4 signer
Package v4 implements signing for AWS V4 signer
stscreds
Package stscreds are credential Providers to retrieve STS AWS credentials.
Package stscreds are credential Providers to retrieve STS AWS credentials.
internal
awstesting/unit
Package unit performs initialization and validation for unit tests
Package unit performs initialization and validation for unit tests
sdk
models
endpoints
Package endpoints contains the models for endpoints that should be used to generate endpoint definition files for the SDK.
Package endpoints contains the models for endpoints that should be used to generate endpoint definition files for the SDK.
private
protocol/ec2query
Package ec2query provides serialization of AWS EC2 requests and responses.
Package ec2query provides serialization of AWS EC2 requests and responses.
protocol/json/jsonutil
Package jsonutil provides JSON serialization of AWS requests and responses.
Package jsonutil provides JSON serialization of AWS requests and responses.
protocol/jsonrpc
Package jsonrpc provides JSON RPC utilities for serialization of AWS requests and responses.
Package jsonrpc provides JSON RPC utilities for serialization of AWS requests and responses.
protocol/query
Package query provides serialization of AWS query requests, and responses.
Package query provides serialization of AWS query requests, and responses.
protocol/rest
Package rest provides RESTful serialization of AWS requests and responses.
Package rest provides RESTful serialization of AWS requests and responses.
protocol/restjson
Package restjson provides RESTful JSON serialization of AWS requests and responses.
Package restjson provides RESTful JSON serialization of AWS requests and responses.
protocol/restxml
Package restxml provides RESTful XML serialization of AWS requests and responses.
Package restxml provides RESTful XML serialization of AWS requests and responses.
protocol/xml/xmlutil
Package xmlutil provides XML serialization of AWS requests and responses.
Package xmlutil provides XML serialization of AWS requests and responses.
Package service contains automatically generated AWS clients.
Package service contains automatically generated AWS clients.
acm
Package acm provides the client and types for making API requests to AWS Certificate Manager.
Package acm provides the client and types for making API requests to AWS Certificate Manager.
acm/acmiface
Package acmiface provides an interface to enable mocking the AWS Certificate Manager service client for testing your code.
Package acmiface provides an interface to enable mocking the AWS Certificate Manager service client for testing your code.
acmpca
Package acmpca provides the client and types for making API requests to AWS Certificate Manager Private Certificate Authority.
Package acmpca provides the client and types for making API requests to AWS Certificate Manager Private Certificate Authority.
acmpca/acmpcaiface
Package acmpcaiface provides an interface to enable mocking the AWS Certificate Manager Private Certificate Authority service client for testing your code.
Package acmpcaiface provides an interface to enable mocking the AWS Certificate Manager Private Certificate Authority service client for testing your code.
alexaforbusiness
Package alexaforbusiness provides the client and types for making API requests to Alexa For Business.
Package alexaforbusiness provides the client and types for making API requests to Alexa For Business.
alexaforbusiness/alexaforbusinessiface
Package alexaforbusinessiface provides an interface to enable mocking the Alexa For Business service client for testing your code.
Package alexaforbusinessiface provides an interface to enable mocking the Alexa For Business service client for testing your code.
apigateway
Package apigateway provides the client and types for making API requests to Amazon API Gateway.
Package apigateway provides the client and types for making API requests to Amazon API Gateway.
apigateway/apigatewayiface
Package apigatewayiface provides an interface to enable mocking the Amazon API Gateway service client for testing your code.
Package apigatewayiface provides an interface to enable mocking the Amazon API Gateway service client for testing your code.
applicationautoscaling
Package applicationautoscaling provides the client and types for making API requests to Application Auto Scaling.
Package applicationautoscaling provides the client and types for making API requests to Application Auto Scaling.
applicationautoscaling/applicationautoscalingiface
Package applicationautoscalingiface provides an interface to enable mocking the Application Auto Scaling service client for testing your code.
Package applicationautoscalingiface provides an interface to enable mocking the Application Auto Scaling service client for testing your code.
applicationdiscoveryservice
Package applicationdiscoveryservice provides the client and types for making API requests to AWS Application Discovery Service.
Package applicationdiscoveryservice provides the client and types for making API requests to AWS Application Discovery Service.
applicationdiscoveryservice/applicationdiscoveryserviceiface
Package applicationdiscoveryserviceiface provides an interface to enable mocking the AWS Application Discovery Service service client for testing your code.
Package applicationdiscoveryserviceiface provides an interface to enable mocking the AWS Application Discovery Service service client for testing your code.
appstream
Package appstream provides the client and types for making API requests to Amazon AppStream.
Package appstream provides the client and types for making API requests to Amazon AppStream.
appstream/appstreamiface
Package appstreamiface provides an interface to enable mocking the Amazon AppStream service client for testing your code.
Package appstreamiface provides an interface to enable mocking the Amazon AppStream service client for testing your code.
appsync
Package appsync provides the client and types for making API requests to AWS AppSync.
Package appsync provides the client and types for making API requests to AWS AppSync.
appsync/appsynciface
Package appsynciface provides an interface to enable mocking the AWS AppSync service client for testing your code.
Package appsynciface provides an interface to enable mocking the AWS AppSync service client for testing your code.
athena
Package athena provides the client and types for making API requests to Amazon Athena.
Package athena provides the client and types for making API requests to Amazon Athena.
athena/athenaiface
Package athenaiface provides an interface to enable mocking the Amazon Athena service client for testing your code.
Package athenaiface provides an interface to enable mocking the Amazon Athena service client for testing your code.
autoscaling
Package autoscaling provides the client and types for making API requests to Auto Scaling.
Package autoscaling provides the client and types for making API requests to Auto Scaling.
autoscaling/autoscalingiface
Package autoscalingiface provides an interface to enable mocking the Auto Scaling service client for testing your code.
Package autoscalingiface provides an interface to enable mocking the Auto Scaling service client for testing your code.
autoscalingplans
Package autoscalingplans provides the client and types for making API requests to AWS Auto Scaling Plans.
Package autoscalingplans provides the client and types for making API requests to AWS Auto Scaling Plans.
autoscalingplans/autoscalingplansiface
Package autoscalingplansiface provides an interface to enable mocking the AWS Auto Scaling Plans service client for testing your code.
Package autoscalingplansiface provides an interface to enable mocking the AWS Auto Scaling Plans service client for testing your code.
batch
Package batch provides the client and types for making API requests to AWS Batch.
Package batch provides the client and types for making API requests to AWS Batch.
batch/batchiface
Package batchiface provides an interface to enable mocking the AWS Batch service client for testing your code.
Package batchiface provides an interface to enable mocking the AWS Batch service client for testing your code.
budgets
Package budgets provides the client and types for making API requests to AWS Budgets.
Package budgets provides the client and types for making API requests to AWS Budgets.
budgets/budgetsiface
Package budgetsiface provides an interface to enable mocking the AWS Budgets service client for testing your code.
Package budgetsiface provides an interface to enable mocking the AWS Budgets service client for testing your code.
cloud9
Package cloud9 provides the client and types for making API requests to AWS Cloud9.
Package cloud9 provides the client and types for making API requests to AWS Cloud9.
cloud9/cloud9iface
Package cloud9iface provides an interface to enable mocking the AWS Cloud9 service client for testing your code.
Package cloud9iface provides an interface to enable mocking the AWS Cloud9 service client for testing your code.
clouddirectory
Package clouddirectory provides the client and types for making API requests to Amazon CloudDirectory.
Package clouddirectory provides the client and types for making API requests to Amazon CloudDirectory.
clouddirectory/clouddirectoryiface
Package clouddirectoryiface provides an interface to enable mocking the Amazon CloudDirectory service client for testing your code.
Package clouddirectoryiface provides an interface to enable mocking the Amazon CloudDirectory service client for testing your code.
cloudformation
Package cloudformation provides the client and types for making API requests to AWS CloudFormation.
Package cloudformation provides the client and types for making API requests to AWS CloudFormation.
cloudformation/cloudformationiface
Package cloudformationiface provides an interface to enable mocking the AWS CloudFormation service client for testing your code.
Package cloudformationiface provides an interface to enable mocking the AWS CloudFormation service client for testing your code.
cloudfront
Package cloudfront provides the client and types for making API requests to Amazon CloudFront.
Package cloudfront provides the client and types for making API requests to Amazon CloudFront.
cloudfront/cloudfrontiface
Package cloudfrontiface provides an interface to enable mocking the Amazon CloudFront service client for testing your code.
Package cloudfrontiface provides an interface to enable mocking the Amazon CloudFront service client for testing your code.
cloudfront/sign
Package sign provides utilities to generate signed URLs for Amazon CloudFront.
Package sign provides utilities to generate signed URLs for Amazon CloudFront.
cloudhsm
Package cloudhsm provides the client and types for making API requests to Amazon CloudHSM.
Package cloudhsm provides the client and types for making API requests to Amazon CloudHSM.
cloudhsm/cloudhsmiface
Package cloudhsmiface provides an interface to enable mocking the Amazon CloudHSM service client for testing your code.
Package cloudhsmiface provides an interface to enable mocking the Amazon CloudHSM service client for testing your code.
cloudhsmv2
Package cloudhsmv2 provides the client and types for making API requests to AWS CloudHSM V2.
Package cloudhsmv2 provides the client and types for making API requests to AWS CloudHSM V2.
cloudhsmv2/cloudhsmv2iface
Package cloudhsmv2iface provides an interface to enable mocking the AWS CloudHSM V2 service client for testing your code.
Package cloudhsmv2iface provides an interface to enable mocking the AWS CloudHSM V2 service client for testing your code.
cloudsearch
Package cloudsearch provides the client and types for making API requests to Amazon CloudSearch.
Package cloudsearch provides the client and types for making API requests to Amazon CloudSearch.
cloudsearch/cloudsearchiface
Package cloudsearchiface provides an interface to enable mocking the Amazon CloudSearch service client for testing your code.
Package cloudsearchiface provides an interface to enable mocking the Amazon CloudSearch service client for testing your code.
cloudsearchdomain
Package cloudsearchdomain provides the client and types for making API requests to Amazon CloudSearch Domain.
Package cloudsearchdomain provides the client and types for making API requests to Amazon CloudSearch Domain.
cloudsearchdomain/cloudsearchdomainiface
Package cloudsearchdomainiface provides an interface to enable mocking the Amazon CloudSearch Domain service client for testing your code.
Package cloudsearchdomainiface provides an interface to enable mocking the Amazon CloudSearch Domain service client for testing your code.
cloudtrail
Package cloudtrail provides the client and types for making API requests to AWS CloudTrail.
Package cloudtrail provides the client and types for making API requests to AWS CloudTrail.
cloudtrail/cloudtrailiface
Package cloudtrailiface provides an interface to enable mocking the AWS CloudTrail service client for testing your code.
Package cloudtrailiface provides an interface to enable mocking the AWS CloudTrail service client for testing your code.
cloudwatch
Package cloudwatch provides the client and types for making API requests to Amazon CloudWatch.
Package cloudwatch provides the client and types for making API requests to Amazon CloudWatch.
cloudwatch/cloudwatchiface
Package cloudwatchiface provides an interface to enable mocking the Amazon CloudWatch service client for testing your code.
Package cloudwatchiface provides an interface to enable mocking the Amazon CloudWatch service client for testing your code.
cloudwatchevents
Package cloudwatchevents provides the client and types for making API requests to Amazon CloudWatch Events.
Package cloudwatchevents provides the client and types for making API requests to Amazon CloudWatch Events.
cloudwatchevents/cloudwatcheventsiface
Package cloudwatcheventsiface provides an interface to enable mocking the Amazon CloudWatch Events service client for testing your code.
Package cloudwatcheventsiface provides an interface to enable mocking the Amazon CloudWatch Events service client for testing your code.
cloudwatchlogs
Package cloudwatchlogs provides the client and types for making API requests to Amazon CloudWatch Logs.
Package cloudwatchlogs provides the client and types for making API requests to Amazon CloudWatch Logs.
cloudwatchlogs/cloudwatchlogsiface
Package cloudwatchlogsiface provides an interface to enable mocking the Amazon CloudWatch Logs service client for testing your code.
Package cloudwatchlogsiface provides an interface to enable mocking the Amazon CloudWatch Logs service client for testing your code.
codebuild
Package codebuild provides the client and types for making API requests to AWS CodeBuild.
Package codebuild provides the client and types for making API requests to AWS CodeBuild.
codebuild/codebuildiface
Package codebuildiface provides an interface to enable mocking the AWS CodeBuild service client for testing your code.
Package codebuildiface provides an interface to enable mocking the AWS CodeBuild service client for testing your code.
codecommit
Package codecommit provides the client and types for making API requests to AWS CodeCommit.
Package codecommit provides the client and types for making API requests to AWS CodeCommit.
codecommit/codecommitiface
Package codecommitiface provides an interface to enable mocking the AWS CodeCommit service client for testing your code.
Package codecommitiface provides an interface to enable mocking the AWS CodeCommit service client for testing your code.
codedeploy
Package codedeploy provides the client and types for making API requests to AWS CodeDeploy.
Package codedeploy provides the client and types for making API requests to AWS CodeDeploy.
codedeploy/codedeployiface
Package codedeployiface provides an interface to enable mocking the AWS CodeDeploy service client for testing your code.
Package codedeployiface provides an interface to enable mocking the AWS CodeDeploy service client for testing your code.
codepipeline
Package codepipeline provides the client and types for making API requests to AWS CodePipeline.
Package codepipeline provides the client and types for making API requests to AWS CodePipeline.
codepipeline/codepipelineiface
Package codepipelineiface provides an interface to enable mocking the AWS CodePipeline service client for testing your code.
Package codepipelineiface provides an interface to enable mocking the AWS CodePipeline service client for testing your code.
codestar
Package codestar provides the client and types for making API requests to AWS CodeStar.
Package codestar provides the client and types for making API requests to AWS CodeStar.
codestar/codestariface
Package codestariface provides an interface to enable mocking the AWS CodeStar service client for testing your code.
Package codestariface provides an interface to enable mocking the AWS CodeStar service client for testing your code.
cognitoidentity
Package cognitoidentity provides the client and types for making API requests to Amazon Cognito Identity.
Package cognitoidentity provides the client and types for making API requests to Amazon Cognito Identity.
cognitoidentity/cognitoidentityiface
Package cognitoidentityiface provides an interface to enable mocking the Amazon Cognito Identity service client for testing your code.
Package cognitoidentityiface provides an interface to enable mocking the Amazon Cognito Identity service client for testing your code.
cognitoidentityprovider
Package cognitoidentityprovider provides the client and types for making API requests to Amazon Cognito Identity Provider.
Package cognitoidentityprovider provides the client and types for making API requests to Amazon Cognito Identity Provider.
cognitoidentityprovider/cognitoidentityprovideriface
Package cognitoidentityprovideriface provides an interface to enable mocking the Amazon Cognito Identity Provider service client for testing your code.
Package cognitoidentityprovideriface provides an interface to enable mocking the Amazon Cognito Identity Provider service client for testing your code.
cognitosync
Package cognitosync provides the client and types for making API requests to Amazon Cognito Sync.
Package cognitosync provides the client and types for making API requests to Amazon Cognito Sync.
cognitosync/cognitosynciface
Package cognitosynciface provides an interface to enable mocking the Amazon Cognito Sync service client for testing your code.
Package cognitosynciface provides an interface to enable mocking the Amazon Cognito Sync service client for testing your code.
comprehend
Package comprehend provides the client and types for making API requests to Amazon Comprehend.
Package comprehend provides the client and types for making API requests to Amazon Comprehend.
comprehend/comprehendiface
Package comprehendiface provides an interface to enable mocking the Amazon Comprehend service client for testing your code.
Package comprehendiface provides an interface to enable mocking the Amazon Comprehend service client for testing your code.
configservice
Package configservice provides the client and types for making API requests to AWS Config.
Package configservice provides the client and types for making API requests to AWS Config.
configservice/configserviceiface
Package configserviceiface provides an interface to enable mocking the AWS Config service client for testing your code.
Package configserviceiface provides an interface to enable mocking the AWS Config service client for testing your code.
connect
Package connect provides the client and types for making API requests to Amazon Connect Service.
Package connect provides the client and types for making API requests to Amazon Connect Service.
connect/connectiface
Package connectiface provides an interface to enable mocking the Amazon Connect Service service client for testing your code.
Package connectiface provides an interface to enable mocking the Amazon Connect Service service client for testing your code.
costandusagereportservice
Package costandusagereportservice provides the client and types for making API requests to AWS Cost and Usage Report Service.
Package costandusagereportservice provides the client and types for making API requests to AWS Cost and Usage Report Service.
costandusagereportservice/costandusagereportserviceiface
Package costandusagereportserviceiface provides an interface to enable mocking the AWS Cost and Usage Report Service service client for testing your code.
Package costandusagereportserviceiface provides an interface to enable mocking the AWS Cost and Usage Report Service service client for testing your code.
costexplorer
Package costexplorer provides the client and types for making API requests to AWS Cost Explorer Service.
Package costexplorer provides the client and types for making API requests to AWS Cost Explorer Service.
costexplorer/costexploreriface
Package costexploreriface provides an interface to enable mocking the AWS Cost Explorer Service service client for testing your code.
Package costexploreriface provides an interface to enable mocking the AWS Cost Explorer Service service client for testing your code.
databasemigrationservice
Package databasemigrationservice provides the client and types for making API requests to AWS Database Migration Service.
Package databasemigrationservice provides the client and types for making API requests to AWS Database Migration Service.
databasemigrationservice/databasemigrationserviceiface
Package databasemigrationserviceiface provides an interface to enable mocking the AWS Database Migration Service service client for testing your code.
Package databasemigrationserviceiface provides an interface to enable mocking the AWS Database Migration Service service client for testing your code.
datapipeline
Package datapipeline provides the client and types for making API requests to AWS Data Pipeline.
Package datapipeline provides the client and types for making API requests to AWS Data Pipeline.
datapipeline/datapipelineiface
Package datapipelineiface provides an interface to enable mocking the AWS Data Pipeline service client for testing your code.
Package datapipelineiface provides an interface to enable mocking the AWS Data Pipeline service client for testing your code.
dax
Package dax provides the client and types for making API requests to Amazon DynamoDB Accelerator (DAX).
Package dax provides the client and types for making API requests to Amazon DynamoDB Accelerator (DAX).
dax/daxiface
Package daxiface provides an interface to enable mocking the Amazon DynamoDB Accelerator (DAX) service client for testing your code.
Package daxiface provides an interface to enable mocking the Amazon DynamoDB Accelerator (DAX) service client for testing your code.
devicefarm
Package devicefarm provides the client and types for making API requests to AWS Device Farm.
Package devicefarm provides the client and types for making API requests to AWS Device Farm.
devicefarm/devicefarmiface
Package devicefarmiface provides an interface to enable mocking the AWS Device Farm service client for testing your code.
Package devicefarmiface provides an interface to enable mocking the AWS Device Farm service client for testing your code.
directconnect
Package directconnect provides the client and types for making API requests to AWS Direct Connect.
Package directconnect provides the client and types for making API requests to AWS Direct Connect.
directconnect/directconnectiface
Package directconnectiface provides an interface to enable mocking the AWS Direct Connect service client for testing your code.
Package directconnectiface provides an interface to enable mocking the AWS Direct Connect service client for testing your code.
directoryservice
Package directoryservice provides the client and types for making API requests to AWS Directory Service.
Package directoryservice provides the client and types for making API requests to AWS Directory Service.
directoryservice/directoryserviceiface
Package directoryserviceiface provides an interface to enable mocking the AWS Directory Service service client for testing your code.
Package directoryserviceiface provides an interface to enable mocking the AWS Directory Service service client for testing your code.
dynamodb
Package dynamodb provides the client and types for making API requests to Amazon DynamoDB.
Package dynamodb provides the client and types for making API requests to Amazon DynamoDB.
dynamodb/dynamodbattribute
Package dynamodbattribute provides marshaling and unmarshaling utilities to convert between Go types and dynamodb.AttributeValues.
Package dynamodbattribute provides marshaling and unmarshaling utilities to convert between Go types and dynamodb.AttributeValues.
dynamodb/dynamodbiface
Package dynamodbiface provides an interface to enable mocking the Amazon DynamoDB service client for testing your code.
Package dynamodbiface provides an interface to enable mocking the Amazon DynamoDB service client for testing your code.
dynamodb/expression
Package expression provides types and functions to create Amazon DynamoDB Expression strings, ExpressionAttributeNames maps, and ExpressionAttributeValues maps.
Package expression provides types and functions to create Amazon DynamoDB Expression strings, ExpressionAttributeNames maps, and ExpressionAttributeValues maps.
dynamodbstreams
Package dynamodbstreams provides the client and types for making API requests to Amazon DynamoDB Streams.
Package dynamodbstreams provides the client and types for making API requests to Amazon DynamoDB Streams.
dynamodbstreams/dynamodbstreamsiface
Package dynamodbstreamsiface provides an interface to enable mocking the Amazon DynamoDB Streams service client for testing your code.
Package dynamodbstreamsiface provides an interface to enable mocking the Amazon DynamoDB Streams service client for testing your code.
ec2
Package ec2 provides the client and types for making API requests to Amazon Elastic Compute Cloud.
Package ec2 provides the client and types for making API requests to Amazon Elastic Compute Cloud.
ec2/ec2iface
Package ec2iface provides an interface to enable mocking the Amazon Elastic Compute Cloud service client for testing your code.
Package ec2iface provides an interface to enable mocking the Amazon Elastic Compute Cloud service client for testing your code.
ecr
Package ecr provides the client and types for making API requests to Amazon EC2 Container Registry.
Package ecr provides the client and types for making API requests to Amazon EC2 Container Registry.
ecr/ecriface
Package ecriface provides an interface to enable mocking the Amazon EC2 Container Registry service client for testing your code.
Package ecriface provides an interface to enable mocking the Amazon EC2 Container Registry service client for testing your code.
ecs
Package ecs provides the client and types for making API requests to Amazon EC2 Container Service.
Package ecs provides the client and types for making API requests to Amazon EC2 Container Service.
ecs/ecsiface
Package ecsiface provides an interface to enable mocking the Amazon EC2 Container Service service client for testing your code.
Package ecsiface provides an interface to enable mocking the Amazon EC2 Container Service service client for testing your code.
efs
Package efs provides the client and types for making API requests to Amazon Elastic File System.
Package efs provides the client and types for making API requests to Amazon Elastic File System.
efs/efsiface
Package efsiface provides an interface to enable mocking the Amazon Elastic File System service client for testing your code.
Package efsiface provides an interface to enable mocking the Amazon Elastic File System service client for testing your code.
elasticache
Package elasticache provides the client and types for making API requests to Amazon ElastiCache.
Package elasticache provides the client and types for making API requests to Amazon ElastiCache.
elasticache/elasticacheiface
Package elasticacheiface provides an interface to enable mocking the Amazon ElastiCache service client for testing your code.
Package elasticacheiface provides an interface to enable mocking the Amazon ElastiCache service client for testing your code.
elasticbeanstalk
Package elasticbeanstalk provides the client and types for making API requests to AWS Elastic Beanstalk.
Package elasticbeanstalk provides the client and types for making API requests to AWS Elastic Beanstalk.
elasticbeanstalk/elasticbeanstalkiface
Package elasticbeanstalkiface provides an interface to enable mocking the AWS Elastic Beanstalk service client for testing your code.
Package elasticbeanstalkiface provides an interface to enable mocking the AWS Elastic Beanstalk service client for testing your code.
elasticsearchservice
Package elasticsearchservice provides the client and types for making API requests to Amazon Elasticsearch Service.
Package elasticsearchservice provides the client and types for making API requests to Amazon Elasticsearch Service.
elasticsearchservice/elasticsearchserviceiface
Package elasticsearchserviceiface provides an interface to enable mocking the Amazon Elasticsearch Service service client for testing your code.
Package elasticsearchserviceiface provides an interface to enable mocking the Amazon Elasticsearch Service service client for testing your code.
elastictranscoder
Package elastictranscoder provides the client and types for making API requests to Amazon Elastic Transcoder.
Package elastictranscoder provides the client and types for making API requests to Amazon Elastic Transcoder.
elastictranscoder/elastictranscoderiface
Package elastictranscoderiface provides an interface to enable mocking the Amazon Elastic Transcoder service client for testing your code.
Package elastictranscoderiface provides an interface to enable mocking the Amazon Elastic Transcoder service client for testing your code.
elb
Package elb provides the client and types for making API requests to Elastic Load Balancing.
Package elb provides the client and types for making API requests to Elastic Load Balancing.
elb/elbiface
Package elbiface provides an interface to enable mocking the Elastic Load Balancing service client for testing your code.
Package elbiface provides an interface to enable mocking the Elastic Load Balancing service client for testing your code.
elbv2
Package elbv2 provides the client and types for making API requests to Elastic Load Balancing.
Package elbv2 provides the client and types for making API requests to Elastic Load Balancing.
elbv2/elbv2iface
Package elbv2iface provides an interface to enable mocking the Elastic Load Balancing service client for testing your code.
Package elbv2iface provides an interface to enable mocking the Elastic Load Balancing service client for testing your code.
emr
Package emr provides the client and types for making API requests to Amazon Elastic MapReduce.
Package emr provides the client and types for making API requests to Amazon Elastic MapReduce.
emr/emriface
Package emriface provides an interface to enable mocking the Amazon Elastic MapReduce service client for testing your code.
Package emriface provides an interface to enable mocking the Amazon Elastic MapReduce service client for testing your code.
firehose
Package firehose provides the client and types for making API requests to Amazon Kinesis Firehose.
Package firehose provides the client and types for making API requests to Amazon Kinesis Firehose.
firehose/firehoseiface
Package firehoseiface provides an interface to enable mocking the Amazon Kinesis Firehose service client for testing your code.
Package firehoseiface provides an interface to enable mocking the Amazon Kinesis Firehose service client for testing your code.
fms
Package fms provides the client and types for making API requests to Firewall Management Service.
Package fms provides the client and types for making API requests to Firewall Management Service.
fms/fmsiface
Package fmsiface provides an interface to enable mocking the Firewall Management Service service client for testing your code.
Package fmsiface provides an interface to enable mocking the Firewall Management Service service client for testing your code.
gamelift
Package gamelift provides the client and types for making API requests to Amazon GameLift.
Package gamelift provides the client and types for making API requests to Amazon GameLift.
gamelift/gameliftiface
Package gameliftiface provides an interface to enable mocking the Amazon GameLift service client for testing your code.
Package gameliftiface provides an interface to enable mocking the Amazon GameLift service client for testing your code.
glacier
Package glacier provides the client and types for making API requests to Amazon Glacier.
Package glacier provides the client and types for making API requests to Amazon Glacier.
glacier/glacieriface
Package glacieriface provides an interface to enable mocking the Amazon Glacier service client for testing your code.
Package glacieriface provides an interface to enable mocking the Amazon Glacier service client for testing your code.
glue
Package glue provides the client and types for making API requests to AWS Glue.
Package glue provides the client and types for making API requests to AWS Glue.
glue/glueiface
Package glueiface provides an interface to enable mocking the AWS Glue service client for testing your code.
Package glueiface provides an interface to enable mocking the AWS Glue service client for testing your code.
greengrass
Package greengrass provides the client and types for making API requests to AWS Greengrass.
Package greengrass provides the client and types for making API requests to AWS Greengrass.
greengrass/greengrassiface
Package greengrassiface provides an interface to enable mocking the AWS Greengrass service client for testing your code.
Package greengrassiface provides an interface to enable mocking the AWS Greengrass service client for testing your code.
guardduty
Package guardduty provides the client and types for making API requests to Amazon GuardDuty.
Package guardduty provides the client and types for making API requests to Amazon GuardDuty.
guardduty/guarddutyiface
Package guarddutyiface provides an interface to enable mocking the Amazon GuardDuty service client for testing your code.
Package guarddutyiface provides an interface to enable mocking the Amazon GuardDuty service client for testing your code.
health
Package health provides the client and types for making API requests to AWS Health APIs and Notifications.
Package health provides the client and types for making API requests to AWS Health APIs and Notifications.
health/healthiface
Package healthiface provides an interface to enable mocking the AWS Health APIs and Notifications service client for testing your code.
Package healthiface provides an interface to enable mocking the AWS Health APIs and Notifications service client for testing your code.
iam
Package iam provides the client and types for making API requests to AWS Identity and Access Management.
Package iam provides the client and types for making API requests to AWS Identity and Access Management.
iam/iamiface
Package iamiface provides an interface to enable mocking the AWS Identity and Access Management service client for testing your code.
Package iamiface provides an interface to enable mocking the AWS Identity and Access Management service client for testing your code.
inspector
Package inspector provides the client and types for making API requests to Amazon Inspector.
Package inspector provides the client and types for making API requests to Amazon Inspector.
inspector/inspectoriface
Package inspectoriface provides an interface to enable mocking the Amazon Inspector service client for testing your code.
Package inspectoriface provides an interface to enable mocking the Amazon Inspector service client for testing your code.
iot
Package iot provides the client and types for making API requests to AWS IoT.
Package iot provides the client and types for making API requests to AWS IoT.
iot/iotiface
Package iotiface provides an interface to enable mocking the AWS IoT service client for testing your code.
Package iotiface provides an interface to enable mocking the AWS IoT service client for testing your code.
iot1clickdevicesservice
Package iot1clickdevicesservice provides the client and types for making API requests to AWS IoT 1-Click Devices Service.
Package iot1clickdevicesservice provides the client and types for making API requests to AWS IoT 1-Click Devices Service.
iot1clickdevicesservice/iot1clickdevicesserviceiface
Package iot1clickdevicesserviceiface provides an interface to enable mocking the AWS IoT 1-Click Devices Service service client for testing your code.
Package iot1clickdevicesserviceiface provides an interface to enable mocking the AWS IoT 1-Click Devices Service service client for testing your code.
iot1clickprojects
Package iot1clickprojects provides the client and types for making API requests to AWS IoT 1-Click Projects Service.
Package iot1clickprojects provides the client and types for making API requests to AWS IoT 1-Click Projects Service.
iot1clickprojects/iot1clickprojectsiface
Package iot1clickprojectsiface provides an interface to enable mocking the AWS IoT 1-Click Projects Service service client for testing your code.
Package iot1clickprojectsiface provides an interface to enable mocking the AWS IoT 1-Click Projects Service service client for testing your code.
iotanalytics
Package iotanalytics provides the client and types for making API requests to AWS IoT Analytics.
Package iotanalytics provides the client and types for making API requests to AWS IoT Analytics.
iotanalytics/iotanalyticsiface
Package iotanalyticsiface provides an interface to enable mocking the AWS IoT Analytics service client for testing your code.
Package iotanalyticsiface provides an interface to enable mocking the AWS IoT Analytics service client for testing your code.
iotdataplane
Package iotdataplane provides the client and types for making API requests to AWS IoT Data Plane.
Package iotdataplane provides the client and types for making API requests to AWS IoT Data Plane.
iotdataplane/iotdataplaneiface
Package iotdataplaneiface provides an interface to enable mocking the AWS IoT Data Plane service client for testing your code.
Package iotdataplaneiface provides an interface to enable mocking the AWS IoT Data Plane service client for testing your code.
iotjobsdataplane
Package iotjobsdataplane provides the client and types for making API requests to AWS IoT Jobs Data Plane.
Package iotjobsdataplane provides the client and types for making API requests to AWS IoT Jobs Data Plane.
iotjobsdataplane/iotjobsdataplaneiface
Package iotjobsdataplaneiface provides an interface to enable mocking the AWS IoT Jobs Data Plane service client for testing your code.
Package iotjobsdataplaneiface provides an interface to enable mocking the AWS IoT Jobs Data Plane service client for testing your code.
kinesis
Package kinesis provides the client and types for making API requests to Amazon Kinesis.
Package kinesis provides the client and types for making API requests to Amazon Kinesis.
kinesis/kinesisiface
Package kinesisiface provides an interface to enable mocking the Amazon Kinesis service client for testing your code.
Package kinesisiface provides an interface to enable mocking the Amazon Kinesis service client for testing your code.
kinesisanalytics
Package kinesisanalytics provides the client and types for making API requests to Amazon Kinesis Analytics.
Package kinesisanalytics provides the client and types for making API requests to Amazon Kinesis Analytics.
kinesisanalytics/kinesisanalyticsiface
Package kinesisanalyticsiface provides an interface to enable mocking the Amazon Kinesis Analytics service client for testing your code.
Package kinesisanalyticsiface provides an interface to enable mocking the Amazon Kinesis Analytics service client for testing your code.
kinesisvideo
Package kinesisvideo provides the client and types for making API requests to Amazon Kinesis Video Streams.
Package kinesisvideo provides the client and types for making API requests to Amazon Kinesis Video Streams.
kinesisvideo/kinesisvideoiface
Package kinesisvideoiface provides an interface to enable mocking the Amazon Kinesis Video Streams service client for testing your code.
Package kinesisvideoiface provides an interface to enable mocking the Amazon Kinesis Video Streams service client for testing your code.
kinesisvideoarchivedmedia
Package kinesisvideoarchivedmedia provides the client and types for making API requests to Amazon Kinesis Video Streams Archived Media.
Package kinesisvideoarchivedmedia provides the client and types for making API requests to Amazon Kinesis Video Streams Archived Media.
kinesisvideoarchivedmedia/kinesisvideoarchivedmediaiface
Package kinesisvideoarchivedmediaiface provides an interface to enable mocking the Amazon Kinesis Video Streams Archived Media service client for testing your code.
Package kinesisvideoarchivedmediaiface provides an interface to enable mocking the Amazon Kinesis Video Streams Archived Media service client for testing your code.
kinesisvideomedia
Package kinesisvideomedia provides the client and types for making API requests to Amazon Kinesis Video Streams Media.
Package kinesisvideomedia provides the client and types for making API requests to Amazon Kinesis Video Streams Media.
kinesisvideomedia/kinesisvideomediaiface
Package kinesisvideomediaiface provides an interface to enable mocking the Amazon Kinesis Video Streams Media service client for testing your code.
Package kinesisvideomediaiface provides an interface to enable mocking the Amazon Kinesis Video Streams Media service client for testing your code.
kms
Package kms provides the client and types for making API requests to AWS Key Management Service.
Package kms provides the client and types for making API requests to AWS Key Management Service.
kms/kmsiface
Package kmsiface provides an interface to enable mocking the AWS Key Management Service service client for testing your code.
Package kmsiface provides an interface to enable mocking the AWS Key Management Service service client for testing your code.
lambda
Package lambda provides the client and types for making API requests to AWS Lambda.
Package lambda provides the client and types for making API requests to AWS Lambda.
lambda/lambdaiface
Package lambdaiface provides an interface to enable mocking the AWS Lambda service client for testing your code.
Package lambdaiface provides an interface to enable mocking the AWS Lambda service client for testing your code.
lexmodelbuildingservice
Package lexmodelbuildingservice provides the client and types for making API requests to Amazon Lex Model Building Service.
Package lexmodelbuildingservice provides the client and types for making API requests to Amazon Lex Model Building Service.
lexmodelbuildingservice/lexmodelbuildingserviceiface
Package lexmodelbuildingserviceiface provides an interface to enable mocking the Amazon Lex Model Building Service service client for testing your code.
Package lexmodelbuildingserviceiface provides an interface to enable mocking the Amazon Lex Model Building Service service client for testing your code.
lexruntimeservice
Package lexruntimeservice provides the client and types for making API requests to Amazon Lex Runtime Service.
Package lexruntimeservice provides the client and types for making API requests to Amazon Lex Runtime Service.
lexruntimeservice/lexruntimeserviceiface
Package lexruntimeserviceiface provides an interface to enable mocking the Amazon Lex Runtime Service service client for testing your code.
Package lexruntimeserviceiface provides an interface to enable mocking the Amazon Lex Runtime Service service client for testing your code.
lightsail
Package lightsail provides the client and types for making API requests to Amazon Lightsail.
Package lightsail provides the client and types for making API requests to Amazon Lightsail.
lightsail/lightsailiface
Package lightsailiface provides an interface to enable mocking the Amazon Lightsail service client for testing your code.
Package lightsailiface provides an interface to enable mocking the Amazon Lightsail service client for testing your code.
machinelearning
Package machinelearning provides the client and types for making API requests to Amazon Machine Learning.
Package machinelearning provides the client and types for making API requests to Amazon Machine Learning.
machinelearning/machinelearningiface
Package machinelearningiface provides an interface to enable mocking the Amazon Machine Learning service client for testing your code.
Package machinelearningiface provides an interface to enable mocking the Amazon Machine Learning service client for testing your code.
marketplacecommerceanalytics
Package marketplacecommerceanalytics provides the client and types for making API requests to AWS Marketplace Commerce Analytics.
Package marketplacecommerceanalytics provides the client and types for making API requests to AWS Marketplace Commerce Analytics.
marketplacecommerceanalytics/marketplacecommerceanalyticsiface
Package marketplacecommerceanalyticsiface provides an interface to enable mocking the AWS Marketplace Commerce Analytics service client for testing your code.
Package marketplacecommerceanalyticsiface provides an interface to enable mocking the AWS Marketplace Commerce Analytics service client for testing your code.
marketplaceentitlementservice
Package marketplaceentitlementservice provides the client and types for making API requests to AWS Marketplace Entitlement Service.
Package marketplaceentitlementservice provides the client and types for making API requests to AWS Marketplace Entitlement Service.
marketplaceentitlementservice/marketplaceentitlementserviceiface
Package marketplaceentitlementserviceiface provides an interface to enable mocking the AWS Marketplace Entitlement Service service client for testing your code.
Package marketplaceentitlementserviceiface provides an interface to enable mocking the AWS Marketplace Entitlement Service service client for testing your code.
marketplacemetering
Package marketplacemetering provides the client and types for making API requests to AWSMarketplace Metering.
Package marketplacemetering provides the client and types for making API requests to AWSMarketplace Metering.
marketplacemetering/marketplacemeteringiface
Package marketplacemeteringiface provides an interface to enable mocking the AWSMarketplace Metering service client for testing your code.
Package marketplacemeteringiface provides an interface to enable mocking the AWSMarketplace Metering service client for testing your code.
mediaconvert
Package mediaconvert provides the client and types for making API requests to AWS Elemental MediaConvert.
Package mediaconvert provides the client and types for making API requests to AWS Elemental MediaConvert.
mediaconvert/mediaconvertiface
Package mediaconvertiface provides an interface to enable mocking the AWS Elemental MediaConvert service client for testing your code.
Package mediaconvertiface provides an interface to enable mocking the AWS Elemental MediaConvert service client for testing your code.
medialive
Package medialive provides the client and types for making API requests to AWS Elemental MediaLive.
Package medialive provides the client and types for making API requests to AWS Elemental MediaLive.
medialive/medialiveiface
Package medialiveiface provides an interface to enable mocking the AWS Elemental MediaLive service client for testing your code.
Package medialiveiface provides an interface to enable mocking the AWS Elemental MediaLive service client for testing your code.
mediapackage
Package mediapackage provides the client and types for making API requests to AWS Elemental MediaPackage.
Package mediapackage provides the client and types for making API requests to AWS Elemental MediaPackage.
mediapackage/mediapackageiface
Package mediapackageiface provides an interface to enable mocking the AWS Elemental MediaPackage service client for testing your code.
Package mediapackageiface provides an interface to enable mocking the AWS Elemental MediaPackage service client for testing your code.
mediastore
Package mediastore provides the client and types for making API requests to AWS Elemental MediaStore.
Package mediastore provides the client and types for making API requests to AWS Elemental MediaStore.
mediastore/mediastoreiface
Package mediastoreiface provides an interface to enable mocking the AWS Elemental MediaStore service client for testing your code.
Package mediastoreiface provides an interface to enable mocking the AWS Elemental MediaStore service client for testing your code.
mediastoredata
Package mediastoredata provides the client and types for making API requests to AWS Elemental MediaStore Data Plane.
Package mediastoredata provides the client and types for making API requests to AWS Elemental MediaStore Data Plane.
mediastoredata/mediastoredataiface
Package mediastoredataiface provides an interface to enable mocking the AWS Elemental MediaStore Data Plane service client for testing your code.
Package mediastoredataiface provides an interface to enable mocking the AWS Elemental MediaStore Data Plane service client for testing your code.
migrationhub
Package migrationhub provides the client and types for making API requests to AWS Migration Hub.
Package migrationhub provides the client and types for making API requests to AWS Migration Hub.
migrationhub/migrationhubiface
Package migrationhubiface provides an interface to enable mocking the AWS Migration Hub service client for testing your code.
Package migrationhubiface provides an interface to enable mocking the AWS Migration Hub service client for testing your code.
mobile
Package mobile provides the client and types for making API requests to AWS Mobile.
Package mobile provides the client and types for making API requests to AWS Mobile.
mobile/mobileiface
Package mobileiface provides an interface to enable mocking the AWS Mobile service client for testing your code.
Package mobileiface provides an interface to enable mocking the AWS Mobile service client for testing your code.
mobileanalytics
Package mobileanalytics provides the client and types for making API requests to Amazon Mobile Analytics.
Package mobileanalytics provides the client and types for making API requests to Amazon Mobile Analytics.
mobileanalytics/mobileanalyticsiface
Package mobileanalyticsiface provides an interface to enable mocking the Amazon Mobile Analytics service client for testing your code.
Package mobileanalyticsiface provides an interface to enable mocking the Amazon Mobile Analytics service client for testing your code.
mq
Package mq provides the client and types for making API requests to AmazonMQ.
Package mq provides the client and types for making API requests to AmazonMQ.
mq/mqiface
Package mqiface provides an interface to enable mocking the AmazonMQ service client for testing your code.
Package mqiface provides an interface to enable mocking the AmazonMQ service client for testing your code.
mturk
Package mturk provides the client and types for making API requests to Amazon Mechanical Turk.
Package mturk provides the client and types for making API requests to Amazon Mechanical Turk.
mturk/mturkiface
Package mturkiface provides an interface to enable mocking the Amazon Mechanical Turk service client for testing your code.
Package mturkiface provides an interface to enable mocking the Amazon Mechanical Turk service client for testing your code.
opsworks
Package opsworks provides the client and types for making API requests to AWS OpsWorks.
Package opsworks provides the client and types for making API requests to AWS OpsWorks.
opsworks/opsworksiface
Package opsworksiface provides an interface to enable mocking the AWS OpsWorks service client for testing your code.
Package opsworksiface provides an interface to enable mocking the AWS OpsWorks service client for testing your code.
opsworkscm
Package opsworkscm provides the client and types for making API requests to AWS OpsWorks for Chef Automate.
Package opsworkscm provides the client and types for making API requests to AWS OpsWorks for Chef Automate.
opsworkscm/opsworkscmiface
Package opsworkscmiface provides an interface to enable mocking the AWS OpsWorks for Chef Automate service client for testing your code.
Package opsworkscmiface provides an interface to enable mocking the AWS OpsWorks for Chef Automate service client for testing your code.
organizations
Package organizations provides the client and types for making API requests to AWS Organizations.
Package organizations provides the client and types for making API requests to AWS Organizations.
organizations/organizationsiface
Package organizationsiface provides an interface to enable mocking the AWS Organizations service client for testing your code.
Package organizationsiface provides an interface to enable mocking the AWS Organizations service client for testing your code.
pinpoint
Package pinpoint provides the client and types for making API requests to Amazon Pinpoint.
Package pinpoint provides the client and types for making API requests to Amazon Pinpoint.
pinpoint/pinpointiface
Package pinpointiface provides an interface to enable mocking the Amazon Pinpoint service client for testing your code.
Package pinpointiface provides an interface to enable mocking the Amazon Pinpoint service client for testing your code.
polly
Package polly provides the client and types for making API requests to Amazon Polly.
Package polly provides the client and types for making API requests to Amazon Polly.
polly/pollyiface
Package pollyiface provides an interface to enable mocking the Amazon Polly service client for testing your code.
Package pollyiface provides an interface to enable mocking the Amazon Polly service client for testing your code.
pricing
Package pricing provides the client and types for making API requests to AWS Price List Service.
Package pricing provides the client and types for making API requests to AWS Price List Service.
pricing/pricingiface
Package pricingiface provides an interface to enable mocking the AWS Price List Service service client for testing your code.
Package pricingiface provides an interface to enable mocking the AWS Price List Service service client for testing your code.
rds
Package rds provides the client and types for making API requests to Amazon Relational Database Service.
Package rds provides the client and types for making API requests to Amazon Relational Database Service.
rds/rdsiface
Package rdsiface provides an interface to enable mocking the Amazon Relational Database Service service client for testing your code.
Package rdsiface provides an interface to enable mocking the Amazon Relational Database Service service client for testing your code.
redshift
Package redshift provides the client and types for making API requests to Amazon Redshift.
Package redshift provides the client and types for making API requests to Amazon Redshift.
redshift/redshiftiface
Package redshiftiface provides an interface to enable mocking the Amazon Redshift service client for testing your code.
Package redshiftiface provides an interface to enable mocking the Amazon Redshift service client for testing your code.
rekognition
Package rekognition provides the client and types for making API requests to Amazon Rekognition.
Package rekognition provides the client and types for making API requests to Amazon Rekognition.
rekognition/rekognitioniface
Package rekognitioniface provides an interface to enable mocking the Amazon Rekognition service client for testing your code.
Package rekognitioniface provides an interface to enable mocking the Amazon Rekognition service client for testing your code.
resourcegroups
Package resourcegroups provides the client and types for making API requests to AWS Resource Groups.
Package resourcegroups provides the client and types for making API requests to AWS Resource Groups.
resourcegroups/resourcegroupsiface
Package resourcegroupsiface provides an interface to enable mocking the AWS Resource Groups service client for testing your code.
Package resourcegroupsiface provides an interface to enable mocking the AWS Resource Groups service client for testing your code.
resourcegroupstaggingapi
Package resourcegroupstaggingapi provides the client and types for making API requests to AWS Resource Groups Tagging API.
Package resourcegroupstaggingapi provides the client and types for making API requests to AWS Resource Groups Tagging API.
resourcegroupstaggingapi/resourcegroupstaggingapiiface
Package resourcegroupstaggingapiiface provides an interface to enable mocking the AWS Resource Groups Tagging API service client for testing your code.
Package resourcegroupstaggingapiiface provides an interface to enable mocking the AWS Resource Groups Tagging API service client for testing your code.
route53
Package route53 provides the client and types for making API requests to Amazon Route 53.
Package route53 provides the client and types for making API requests to Amazon Route 53.
route53/route53iface
Package route53iface provides an interface to enable mocking the Amazon Route 53 service client for testing your code.
Package route53iface provides an interface to enable mocking the Amazon Route 53 service client for testing your code.
route53domains
Package route53domains provides the client and types for making API requests to Amazon Route 53 Domains.
Package route53domains provides the client and types for making API requests to Amazon Route 53 Domains.
route53domains/route53domainsiface
Package route53domainsiface provides an interface to enable mocking the Amazon Route 53 Domains service client for testing your code.
Package route53domainsiface provides an interface to enable mocking the Amazon Route 53 Domains service client for testing your code.
s3
Package s3 provides the client and types for making API requests to Amazon Simple Storage Service.
Package s3 provides the client and types for making API requests to Amazon Simple Storage Service.
s3/s3crypto
Package s3crypto provides encryption to S3 using KMS and AES GCM.
Package s3crypto provides encryption to S3 using KMS and AES GCM.
s3/s3iface
Package s3iface provides an interface to enable mocking the Amazon Simple Storage Service service client for testing your code.
Package s3iface provides an interface to enable mocking the Amazon Simple Storage Service service client for testing your code.
s3/s3manager
Package s3manager provides utilities to upload and download objects from S3 concurrently.
Package s3manager provides utilities to upload and download objects from S3 concurrently.
s3/s3manager/s3manageriface
Package s3manageriface provides an interface for the s3manager package
Package s3manageriface provides an interface for the s3manager package
sagemaker
Package sagemaker provides the client and types for making API requests to Amazon SageMaker Service.
Package sagemaker provides the client and types for making API requests to Amazon SageMaker Service.
sagemaker/sagemakeriface
Package sagemakeriface provides an interface to enable mocking the Amazon SageMaker Service service client for testing your code.
Package sagemakeriface provides an interface to enable mocking the Amazon SageMaker Service service client for testing your code.
sagemakerruntime
Package sagemakerruntime provides the client and types for making API requests to Amazon SageMaker Runtime.
Package sagemakerruntime provides the client and types for making API requests to Amazon SageMaker Runtime.
sagemakerruntime/sagemakerruntimeiface
Package sagemakerruntimeiface provides an interface to enable mocking the Amazon SageMaker Runtime service client for testing your code.
Package sagemakerruntimeiface provides an interface to enable mocking the Amazon SageMaker Runtime service client for testing your code.
secretsmanager
Package secretsmanager provides the client and types for making API requests to AWS Secrets Manager.
Package secretsmanager provides the client and types for making API requests to AWS Secrets Manager.
secretsmanager/secretsmanageriface
Package secretsmanageriface provides an interface to enable mocking the AWS Secrets Manager service client for testing your code.
Package secretsmanageriface provides an interface to enable mocking the AWS Secrets Manager service client for testing your code.
serverlessapplicationrepository
Package serverlessapplicationrepository provides the client and types for making API requests to AWSServerlessApplicationRepository.
Package serverlessapplicationrepository provides the client and types for making API requests to AWSServerlessApplicationRepository.
serverlessapplicationrepository/serverlessapplicationrepositoryiface
Package serverlessapplicationrepositoryiface provides an interface to enable mocking the AWSServerlessApplicationRepository service client for testing your code.
Package serverlessapplicationrepositoryiface provides an interface to enable mocking the AWSServerlessApplicationRepository service client for testing your code.
servicecatalog
Package servicecatalog provides the client and types for making API requests to AWS Service Catalog.
Package servicecatalog provides the client and types for making API requests to AWS Service Catalog.
servicecatalog/servicecatalogiface
Package servicecatalogiface provides an interface to enable mocking the AWS Service Catalog service client for testing your code.
Package servicecatalogiface provides an interface to enable mocking the AWS Service Catalog service client for testing your code.
servicediscovery
Package servicediscovery provides the client and types for making API requests to Amazon Route 53 Auto Naming.
Package servicediscovery provides the client and types for making API requests to Amazon Route 53 Auto Naming.
servicediscovery/servicediscoveryiface
Package servicediscoveryiface provides an interface to enable mocking the Amazon Route 53 Auto Naming service client for testing your code.
Package servicediscoveryiface provides an interface to enable mocking the Amazon Route 53 Auto Naming service client for testing your code.
ses
Package ses provides the client and types for making API requests to Amazon Simple Email Service.
Package ses provides the client and types for making API requests to Amazon Simple Email Service.
ses/sesiface
Package sesiface provides an interface to enable mocking the Amazon Simple Email Service service client for testing your code.
Package sesiface provides an interface to enable mocking the Amazon Simple Email Service service client for testing your code.
sfn
Package sfn provides the client and types for making API requests to AWS Step Functions.
Package sfn provides the client and types for making API requests to AWS Step Functions.
sfn/sfniface
Package sfniface provides an interface to enable mocking the AWS Step Functions service client for testing your code.
Package sfniface provides an interface to enable mocking the AWS Step Functions service client for testing your code.
shield
Package shield provides the client and types for making API requests to AWS Shield.
Package shield provides the client and types for making API requests to AWS Shield.
shield/shieldiface
Package shieldiface provides an interface to enable mocking the AWS Shield service client for testing your code.
Package shieldiface provides an interface to enable mocking the AWS Shield service client for testing your code.
simpledb
Package simpledb provides the client and types for making API requests to Amazon SimpleDB.
Package simpledb provides the client and types for making API requests to Amazon SimpleDB.
simpledb/simpledbiface
Package simpledbiface provides an interface to enable mocking the Amazon SimpleDB service client for testing your code.
Package simpledbiface provides an interface to enable mocking the Amazon SimpleDB service client for testing your code.
sms
Package sms provides the client and types for making API requests to AWS Server Migration Service.
Package sms provides the client and types for making API requests to AWS Server Migration Service.
sms/smsiface
Package smsiface provides an interface to enable mocking the AWS Server Migration Service service client for testing your code.
Package smsiface provides an interface to enable mocking the AWS Server Migration Service service client for testing your code.
snowball
Package snowball provides the client and types for making API requests to Amazon Import/Export Snowball.
Package snowball provides the client and types for making API requests to Amazon Import/Export Snowball.
snowball/snowballiface
Package snowballiface provides an interface to enable mocking the Amazon Import/Export Snowball service client for testing your code.
Package snowballiface provides an interface to enable mocking the Amazon Import/Export Snowball service client for testing your code.
sns
Package sns provides the client and types for making API requests to Amazon Simple Notification Service.
Package sns provides the client and types for making API requests to Amazon Simple Notification Service.
sns/snsiface
Package snsiface provides an interface to enable mocking the Amazon Simple Notification Service service client for testing your code.
Package snsiface provides an interface to enable mocking the Amazon Simple Notification Service service client for testing your code.
sqs
Package sqs provides the client and types for making API requests to Amazon Simple Queue Service.
Package sqs provides the client and types for making API requests to Amazon Simple Queue Service.
sqs/sqsiface
Package sqsiface provides an interface to enable mocking the Amazon Simple Queue Service service client for testing your code.
Package sqsiface provides an interface to enable mocking the Amazon Simple Queue Service service client for testing your code.
ssm
Package ssm provides the client and types for making API requests to Amazon Simple Systems Manager (SSM).
Package ssm provides the client and types for making API requests to Amazon Simple Systems Manager (SSM).
ssm/ssmiface
Package ssmiface provides an interface to enable mocking the Amazon Simple Systems Manager (SSM) service client for testing your code.
Package ssmiface provides an interface to enable mocking the Amazon Simple Systems Manager (SSM) service client for testing your code.
storagegateway
Package storagegateway provides the client and types for making API requests to AWS Storage Gateway.
Package storagegateway provides the client and types for making API requests to AWS Storage Gateway.
storagegateway/storagegatewayiface
Package storagegatewayiface provides an interface to enable mocking the AWS Storage Gateway service client for testing your code.
Package storagegatewayiface provides an interface to enable mocking the AWS Storage Gateway service client for testing your code.
sts
Package sts provides the client and types for making API requests to AWS Security Token Service.
Package sts provides the client and types for making API requests to AWS Security Token Service.
sts/stsiface
Package stsiface provides an interface to enable mocking the AWS Security Token Service service client for testing your code.
Package stsiface provides an interface to enable mocking the AWS Security Token Service service client for testing your code.
support
Package support provides the client and types for making API requests to AWS Support.
Package support provides the client and types for making API requests to AWS Support.
support/supportiface
Package supportiface provides an interface to enable mocking the AWS Support service client for testing your code.
Package supportiface provides an interface to enable mocking the AWS Support service client for testing your code.
swf
Package swf provides the client and types for making API requests to Amazon Simple Workflow Service.
Package swf provides the client and types for making API requests to Amazon Simple Workflow Service.
swf/swfiface
Package swfiface provides an interface to enable mocking the Amazon Simple Workflow Service service client for testing your code.
Package swfiface provides an interface to enable mocking the Amazon Simple Workflow Service service client for testing your code.
transcribeservice
Package transcribeservice provides the client and types for making API requests to Amazon Transcribe Service.
Package transcribeservice provides the client and types for making API requests to Amazon Transcribe Service.
transcribeservice/transcribeserviceiface
Package transcribeserviceiface provides an interface to enable mocking the Amazon Transcribe Service service client for testing your code.
Package transcribeserviceiface provides an interface to enable mocking the Amazon Transcribe Service service client for testing your code.
translate
Package translate provides the client and types for making API requests to Amazon Translate.
Package translate provides the client and types for making API requests to Amazon Translate.
translate/translateiface
Package translateiface provides an interface to enable mocking the Amazon Translate service client for testing your code.
Package translateiface provides an interface to enable mocking the Amazon Translate service client for testing your code.
waf
Package waf provides the client and types for making API requests to AWS WAF.
Package waf provides the client and types for making API requests to AWS WAF.
waf/wafiface
Package wafiface provides an interface to enable mocking the AWS WAF service client for testing your code.
Package wafiface provides an interface to enable mocking the AWS WAF service client for testing your code.
wafregional
Package wafregional provides the client and types for making API requests to AWS WAF Regional.
Package wafregional provides the client and types for making API requests to AWS WAF Regional.
wafregional/wafregionaliface
Package wafregionaliface provides an interface to enable mocking the AWS WAF Regional service client for testing your code.
Package wafregionaliface provides an interface to enable mocking the AWS WAF Regional service client for testing your code.
workdocs
Package workdocs provides the client and types for making API requests to Amazon WorkDocs.
Package workdocs provides the client and types for making API requests to Amazon WorkDocs.
workdocs/workdocsiface
Package workdocsiface provides an interface to enable mocking the Amazon WorkDocs service client for testing your code.
Package workdocsiface provides an interface to enable mocking the Amazon WorkDocs service client for testing your code.
workmail
Package workmail provides the client and types for making API requests to Amazon WorkMail.
Package workmail provides the client and types for making API requests to Amazon WorkMail.
workmail/workmailiface
Package workmailiface provides an interface to enable mocking the Amazon WorkMail service client for testing your code.
Package workmailiface provides an interface to enable mocking the Amazon WorkMail service client for testing your code.
workspaces
Package workspaces provides the client and types for making API requests to Amazon WorkSpaces.
Package workspaces provides the client and types for making API requests to Amazon WorkSpaces.
workspaces/workspacesiface
Package workspacesiface provides an interface to enable mocking the Amazon WorkSpaces service client for testing your code.
Package workspacesiface provides an interface to enable mocking the Amazon WorkSpaces service client for testing your code.
xray
Package xray provides the client and types for making API requests to AWS X-Ray.
Package xray provides the client and types for making API requests to AWS X-Ray.
xray/xrayiface
Package xrayiface provides an interface to enable mocking the AWS X-Ray service client for testing your code.
Package xrayiface provides an interface to enable mocking the AWS X-Ray service client for testing your code.

Jump to

Keyboard shortcuts

? : This menu
/ : Search site
f or F : Jump to
y or Y : Canonical URL