
Version: v1.44.15 Latest Latest

This package is not in the latest version of its module.

Go to latest
Published: May 16, 2022 License: Apache-2.0 Imports: 0 Imported by: 0



Package service contains automatically generated AWS clients.

Source Files


Path Synopsis
Package accessanalyzer provides the client and types for making API requests to Access Analyzer.
Package accessanalyzer provides the client and types for making API requests to Access Analyzer.
Package accessanalyzeriface provides an interface to enable mocking the Access Analyzer service client for testing your code.
Package accessanalyzeriface provides an interface to enable mocking the Access Analyzer service client for testing your code.
Package account provides the client and types for making API requests to AWS Account.
Package account provides the client and types for making API requests to AWS Account.
Package accountiface provides an interface to enable mocking the AWS Account service client for testing your code.
Package accountiface provides an interface to enable mocking the AWS Account service client for testing your code.
Package acm provides the client and types for making API requests to AWS Certificate Manager.
Package acm provides the client and types for making API requests to AWS Certificate Manager.
Package acmiface provides an interface to enable mocking the AWS Certificate Manager service client for testing your code.
Package acmiface provides an interface to enable mocking the AWS Certificate Manager service client for testing your code.
Package acmpca provides the client and types for making API requests to AWS Certificate Manager Private Certificate Authority.
Package acmpca provides the client and types for making API requests to AWS Certificate Manager Private Certificate Authority.
Package acmpcaiface provides an interface to enable mocking the AWS Certificate Manager Private Certificate Authority service client for testing your code.
Package acmpcaiface provides an interface to enable mocking the AWS Certificate Manager Private Certificate Authority service client for testing your code.
Package alexaforbusiness provides the client and types for making API requests to Alexa For Business.
Package alexaforbusiness provides the client and types for making API requests to Alexa For Business.
Package alexaforbusinessiface provides an interface to enable mocking the Alexa For Business service client for testing your code.
Package alexaforbusinessiface provides an interface to enable mocking the Alexa For Business service client for testing your code.
Package amplify provides the client and types for making API requests to AWS Amplify.
Package amplify provides the client and types for making API requests to AWS Amplify.
Package amplifyiface provides an interface to enable mocking the AWS Amplify service client for testing your code.
Package amplifyiface provides an interface to enable mocking the AWS Amplify service client for testing your code.
Package amplifybackend provides the client and types for making API requests to AmplifyBackend.
Package amplifybackend provides the client and types for making API requests to AmplifyBackend.
Package amplifybackendiface provides an interface to enable mocking the AmplifyBackend service client for testing your code.
Package amplifybackendiface provides an interface to enable mocking the AmplifyBackend service client for testing your code.
Package amplifyuibuilder provides the client and types for making API requests to AWS Amplify UI Builder.
Package amplifyuibuilder provides the client and types for making API requests to AWS Amplify UI Builder.
Package amplifyuibuilderiface provides an interface to enable mocking the AWS Amplify UI Builder service client for testing your code.
Package amplifyuibuilderiface provides an interface to enable mocking the AWS Amplify UI Builder service client for testing your code.
Package apigateway provides the client and types for making API requests to Amazon API Gateway.
Package apigateway provides the client and types for making API requests to Amazon API Gateway.
Package apigatewayiface provides an interface to enable mocking the Amazon API Gateway service client for testing your code.
Package apigatewayiface provides an interface to enable mocking the Amazon API Gateway service client for testing your code.
Package apigatewaymanagementapi provides the client and types for making API requests to AmazonApiGatewayManagementApi.
Package apigatewaymanagementapi provides the client and types for making API requests to AmazonApiGatewayManagementApi.
Package apigatewaymanagementapiiface provides an interface to enable mocking the AmazonApiGatewayManagementApi service client for testing your code.
Package apigatewaymanagementapiiface provides an interface to enable mocking the AmazonApiGatewayManagementApi service client for testing your code.
Package apigatewayv2 provides the client and types for making API requests to AmazonApiGatewayV2.
Package apigatewayv2 provides the client and types for making API requests to AmazonApiGatewayV2.
Package apigatewayv2iface provides an interface to enable mocking the AmazonApiGatewayV2 service client for testing your code.
Package apigatewayv2iface provides an interface to enable mocking the AmazonApiGatewayV2 service client for testing your code.
Package appconfig provides the client and types for making API requests to Amazon AppConfig.
Package appconfig provides the client and types for making API requests to Amazon AppConfig.
Package appconfigiface provides an interface to enable mocking the Amazon AppConfig service client for testing your code.
Package appconfigiface provides an interface to enable mocking the Amazon AppConfig service client for testing your code.
Package appconfigdata provides the client and types for making API requests to AWS AppConfig Data.
Package appconfigdata provides the client and types for making API requests to AWS AppConfig Data.
Package appconfigdataiface provides an interface to enable mocking the AWS AppConfig Data service client for testing your code.
Package appconfigdataiface provides an interface to enable mocking the AWS AppConfig Data service client for testing your code.
Package appflow provides the client and types for making API requests to Amazon Appflow.
Package appflow provides the client and types for making API requests to Amazon Appflow.
Package appflowiface provides an interface to enable mocking the Amazon Appflow service client for testing your code.
Package appflowiface provides an interface to enable mocking the Amazon Appflow service client for testing your code.
Package appintegrationsservice provides the client and types for making API requests to Amazon AppIntegrations Service.
Package appintegrationsservice provides the client and types for making API requests to Amazon AppIntegrations Service.
Package appintegrationsserviceiface provides an interface to enable mocking the Amazon AppIntegrations Service service client for testing your code.
Package appintegrationsserviceiface provides an interface to enable mocking the Amazon AppIntegrations Service service client for testing your code.
Package applicationautoscaling provides the client and types for making API requests to Application Auto Scaling.
Package applicationautoscaling provides the client and types for making API requests to Application Auto Scaling.
Package applicationautoscalingiface provides an interface to enable mocking the Application Auto Scaling service client for testing your code.
Package applicationautoscalingiface provides an interface to enable mocking the Application Auto Scaling service client for testing your code.
Package applicationcostprofiler provides the client and types for making API requests to AWS Application Cost Profiler.
Package applicationcostprofiler provides the client and types for making API requests to AWS Application Cost Profiler.
Package applicationcostprofileriface provides an interface to enable mocking the AWS Application Cost Profiler service client for testing your code.
Package applicationcostprofileriface provides an interface to enable mocking the AWS Application Cost Profiler service client for testing your code.
Package applicationdiscoveryservice provides the client and types for making API requests to AWS Application Discovery Service.
Package applicationdiscoveryservice provides the client and types for making API requests to AWS Application Discovery Service.
Package applicationdiscoveryserviceiface provides an interface to enable mocking the AWS Application Discovery Service service client for testing your code.
Package applicationdiscoveryserviceiface provides an interface to enable mocking the AWS Application Discovery Service service client for testing your code.
Package applicationinsights provides the client and types for making API requests to Amazon CloudWatch Application Insights.
Package applicationinsights provides the client and types for making API requests to Amazon CloudWatch Application Insights.
Package applicationinsightsiface provides an interface to enable mocking the Amazon CloudWatch Application Insights service client for testing your code.
Package applicationinsightsiface provides an interface to enable mocking the Amazon CloudWatch Application Insights service client for testing your code.
Package appmesh provides the client and types for making API requests to AWS App Mesh.
Package appmesh provides the client and types for making API requests to AWS App Mesh.
Package appmeshiface provides an interface to enable mocking the AWS App Mesh service client for testing your code.
Package appmeshiface provides an interface to enable mocking the AWS App Mesh service client for testing your code.
Package appregistry provides the client and types for making API requests to AWS Service Catalog App Registry.
Package appregistry provides the client and types for making API requests to AWS Service Catalog App Registry.
Package appregistryiface provides an interface to enable mocking the AWS Service Catalog App Registry service client for testing your code.
Package appregistryiface provides an interface to enable mocking the AWS Service Catalog App Registry service client for testing your code.
Package apprunner provides the client and types for making API requests to AWS App Runner.
Package apprunner provides the client and types for making API requests to AWS App Runner.
Package apprunneriface provides an interface to enable mocking the AWS App Runner service client for testing your code.
Package apprunneriface provides an interface to enable mocking the AWS App Runner service client for testing your code.
Package appstream provides the client and types for making API requests to Amazon AppStream.
Package appstream provides the client and types for making API requests to Amazon AppStream.
Package appstreamiface provides an interface to enable mocking the Amazon AppStream service client for testing your code.
Package appstreamiface provides an interface to enable mocking the Amazon AppStream service client for testing your code.
Package appsync provides the client and types for making API requests to AWS AppSync.
Package appsync provides the client and types for making API requests to AWS AppSync.
Package appsynciface provides an interface to enable mocking the AWS AppSync service client for testing your code.
Package appsynciface provides an interface to enable mocking the AWS AppSync service client for testing your code.
Package athena provides the client and types for making API requests to Amazon Athena.
Package athena provides the client and types for making API requests to Amazon Athena.
Package athenaiface provides an interface to enable mocking the Amazon Athena service client for testing your code.
Package athenaiface provides an interface to enable mocking the Amazon Athena service client for testing your code.
Package auditmanager provides the client and types for making API requests to AWS Audit Manager.
Package auditmanager provides the client and types for making API requests to AWS Audit Manager.
Package auditmanageriface provides an interface to enable mocking the AWS Audit Manager service client for testing your code.
Package auditmanageriface provides an interface to enable mocking the AWS Audit Manager service client for testing your code.
Package augmentedairuntime provides the client and types for making API requests to Amazon Augmented AI Runtime.
Package augmentedairuntime provides the client and types for making API requests to Amazon Augmented AI Runtime.
Package augmentedairuntimeiface provides an interface to enable mocking the Amazon Augmented AI Runtime service client for testing your code.
Package augmentedairuntimeiface provides an interface to enable mocking the Amazon Augmented AI Runtime service client for testing your code.
Package autoscaling provides the client and types for making API requests to Auto Scaling.
Package autoscaling provides the client and types for making API requests to Auto Scaling.
Package autoscalingiface provides an interface to enable mocking the Auto Scaling service client for testing your code.
Package autoscalingiface provides an interface to enable mocking the Auto Scaling service client for testing your code.
Package autoscalingplans provides the client and types for making API requests to AWS Auto Scaling Plans.
Package autoscalingplans provides the client and types for making API requests to AWS Auto Scaling Plans.
Package autoscalingplansiface provides an interface to enable mocking the AWS Auto Scaling Plans service client for testing your code.
Package autoscalingplansiface provides an interface to enable mocking the AWS Auto Scaling Plans service client for testing your code.
Package backup provides the client and types for making API requests to AWS Backup.
Package backup provides the client and types for making API requests to AWS Backup.
Package backupiface provides an interface to enable mocking the AWS Backup service client for testing your code.
Package backupiface provides an interface to enable mocking the AWS Backup service client for testing your code.
Package backupgateway provides the client and types for making API requests to AWS Backup Gateway.
Package backupgateway provides the client and types for making API requests to AWS Backup Gateway.
Package backupgatewayiface provides an interface to enable mocking the AWS Backup Gateway service client for testing your code.
Package backupgatewayiface provides an interface to enable mocking the AWS Backup Gateway service client for testing your code.
Package batch provides the client and types for making API requests to AWS Batch.
Package batch provides the client and types for making API requests to AWS Batch.
Package batchiface provides an interface to enable mocking the AWS Batch service client for testing your code.
Package batchiface provides an interface to enable mocking the AWS Batch service client for testing your code.
Package billingconductor provides the client and types for making API requests to AWSBillingConductor.
Package billingconductor provides the client and types for making API requests to AWSBillingConductor.
Package billingconductoriface provides an interface to enable mocking the AWSBillingConductor service client for testing your code.
Package billingconductoriface provides an interface to enable mocking the AWSBillingConductor service client for testing your code.
Package braket provides the client and types for making API requests to Braket.
Package braket provides the client and types for making API requests to Braket.
Package braketiface provides an interface to enable mocking the Braket service client for testing your code.
Package braketiface provides an interface to enable mocking the Braket service client for testing your code.
Package budgets provides the client and types for making API requests to AWS Budgets.
Package budgets provides the client and types for making API requests to AWS Budgets.
Package budgetsiface provides an interface to enable mocking the AWS Budgets service client for testing your code.
Package budgetsiface provides an interface to enable mocking the AWS Budgets service client for testing your code.
Package chime provides the client and types for making API requests to Amazon Chime.
Package chime provides the client and types for making API requests to Amazon Chime.
Package chimeiface provides an interface to enable mocking the Amazon Chime service client for testing your code.
Package chimeiface provides an interface to enable mocking the Amazon Chime service client for testing your code.
Package chimesdkidentity provides the client and types for making API requests to Amazon Chime SDK Identity.
Package chimesdkidentity provides the client and types for making API requests to Amazon Chime SDK Identity.
Package chimesdkidentityiface provides an interface to enable mocking the Amazon Chime SDK Identity service client for testing your code.
Package chimesdkidentityiface provides an interface to enable mocking the Amazon Chime SDK Identity service client for testing your code.
Package chimesdkmediapipelines provides the client and types for making API requests to Amazon Chime SDK Media Pipelines.
Package chimesdkmediapipelines provides the client and types for making API requests to Amazon Chime SDK Media Pipelines.
Package chimesdkmediapipelinesiface provides an interface to enable mocking the Amazon Chime SDK Media Pipelines service client for testing your code.
Package chimesdkmediapipelinesiface provides an interface to enable mocking the Amazon Chime SDK Media Pipelines service client for testing your code.
Package chimesdkmeetings provides the client and types for making API requests to Amazon Chime SDK Meetings.
Package chimesdkmeetings provides the client and types for making API requests to Amazon Chime SDK Meetings.
Package chimesdkmeetingsiface provides an interface to enable mocking the Amazon Chime SDK Meetings service client for testing your code.
Package chimesdkmeetingsiface provides an interface to enable mocking the Amazon Chime SDK Meetings service client for testing your code.
Package chimesdkmessaging provides the client and types for making API requests to Amazon Chime SDK Messaging.
Package chimesdkmessaging provides the client and types for making API requests to Amazon Chime SDK Messaging.
Package chimesdkmessagingiface provides an interface to enable mocking the Amazon Chime SDK Messaging service client for testing your code.
Package chimesdkmessagingiface provides an interface to enable mocking the Amazon Chime SDK Messaging service client for testing your code.
Package cloud9 provides the client and types for making API requests to AWS Cloud9.
Package cloud9 provides the client and types for making API requests to AWS Cloud9.
Package cloud9iface provides an interface to enable mocking the AWS Cloud9 service client for testing your code.
Package cloud9iface provides an interface to enable mocking the AWS Cloud9 service client for testing your code.
Package cloudcontrolapi provides the client and types for making API requests to AWS Cloud Control API.
Package cloudcontrolapi provides the client and types for making API requests to AWS Cloud Control API.
Package cloudcontrolapiiface provides an interface to enable mocking the AWS Cloud Control API service client for testing your code.
Package cloudcontrolapiiface provides an interface to enable mocking the AWS Cloud Control API service client for testing your code.
Package clouddirectory provides the client and types for making API requests to Amazon CloudDirectory.
Package clouddirectory provides the client and types for making API requests to Amazon CloudDirectory.
Package clouddirectoryiface provides an interface to enable mocking the Amazon CloudDirectory service client for testing your code.
Package clouddirectoryiface provides an interface to enable mocking the Amazon CloudDirectory service client for testing your code.
Package cloudformation provides the client and types for making API requests to AWS CloudFormation.
Package cloudformation provides the client and types for making API requests to AWS CloudFormation.
Package cloudformationiface provides an interface to enable mocking the AWS CloudFormation service client for testing your code.
Package cloudformationiface provides an interface to enable mocking the AWS CloudFormation service client for testing your code.
Package cloudfront provides the client and types for making API requests to Amazon CloudFront.
Package cloudfront provides the client and types for making API requests to Amazon CloudFront.
Package cloudfrontiface provides an interface to enable mocking the Amazon CloudFront service client for testing your code.
Package cloudfrontiface provides an interface to enable mocking the Amazon CloudFront service client for testing your code.
Package sign provides utilities to generate signed URLs for Amazon CloudFront.
Package sign provides utilities to generate signed URLs for Amazon CloudFront.
Package cloudhsm provides the client and types for making API requests to Amazon CloudHSM.
Package cloudhsm provides the client and types for making API requests to Amazon CloudHSM.
Package cloudhsmiface provides an interface to enable mocking the Amazon CloudHSM service client for testing your code.
Package cloudhsmiface provides an interface to enable mocking the Amazon CloudHSM service client for testing your code.
Package cloudhsmv2 provides the client and types for making API requests to AWS CloudHSM V2.
Package cloudhsmv2 provides the client and types for making API requests to AWS CloudHSM V2.
Package cloudhsmv2iface provides an interface to enable mocking the AWS CloudHSM V2 service client for testing your code.
Package cloudhsmv2iface provides an interface to enable mocking the AWS CloudHSM V2 service client for testing your code.
Package cloudsearch provides the client and types for making API requests to Amazon CloudSearch.
Package cloudsearch provides the client and types for making API requests to Amazon CloudSearch.
Package cloudsearchiface provides an interface to enable mocking the Amazon CloudSearch service client for testing your code.
Package cloudsearchiface provides an interface to enable mocking the Amazon CloudSearch service client for testing your code.
Package cloudsearchdomain provides the client and types for making API requests to Amazon CloudSearch Domain.
Package cloudsearchdomain provides the client and types for making API requests to Amazon CloudSearch Domain.
Package cloudsearchdomainiface provides an interface to enable mocking the Amazon CloudSearch Domain service client for testing your code.
Package cloudsearchdomainiface provides an interface to enable mocking the Amazon CloudSearch Domain service client for testing your code.
Package cloudtrail provides the client and types for making API requests to AWS CloudTrail.
Package cloudtrail provides the client and types for making API requests to AWS CloudTrail.
Package cloudtrailiface provides an interface to enable mocking the AWS CloudTrail service client for testing your code.
Package cloudtrailiface provides an interface to enable mocking the AWS CloudTrail service client for testing your code.
Package cloudwatch provides the client and types for making API requests to Amazon CloudWatch.
Package cloudwatch provides the client and types for making API requests to Amazon CloudWatch.
Package cloudwatchiface provides an interface to enable mocking the Amazon CloudWatch service client for testing your code.
Package cloudwatchiface provides an interface to enable mocking the Amazon CloudWatch service client for testing your code.
Package cloudwatchevents provides the client and types for making API requests to Amazon CloudWatch Events.
Package cloudwatchevents provides the client and types for making API requests to Amazon CloudWatch Events.
Package cloudwatcheventsiface provides an interface to enable mocking the Amazon CloudWatch Events service client for testing your code.
Package cloudwatcheventsiface provides an interface to enable mocking the Amazon CloudWatch Events service client for testing your code.
Package cloudwatchevidently provides the client and types for making API requests to Amazon CloudWatch Evidently.
Package cloudwatchevidently provides the client and types for making API requests to Amazon CloudWatch Evidently.
Package cloudwatchevidentlyiface provides an interface to enable mocking the Amazon CloudWatch Evidently service client for testing your code.
Package cloudwatchevidentlyiface provides an interface to enable mocking the Amazon CloudWatch Evidently service client for testing your code.
Package cloudwatchlogs provides the client and types for making API requests to Amazon CloudWatch Logs.
Package cloudwatchlogs provides the client and types for making API requests to Amazon CloudWatch Logs.
Package cloudwatchlogsiface provides an interface to enable mocking the Amazon CloudWatch Logs service client for testing your code.
Package cloudwatchlogsiface provides an interface to enable mocking the Amazon CloudWatch Logs service client for testing your code.
Package cloudwatchrum provides the client and types for making API requests to CloudWatch RUM.
Package cloudwatchrum provides the client and types for making API requests to CloudWatch RUM.
Package cloudwatchrumiface provides an interface to enable mocking the CloudWatch RUM service client for testing your code.
Package cloudwatchrumiface provides an interface to enable mocking the CloudWatch RUM service client for testing your code.
Package codeartifact provides the client and types for making API requests to CodeArtifact.
Package codeartifact provides the client and types for making API requests to CodeArtifact.
Package codeartifactiface provides an interface to enable mocking the CodeArtifact service client for testing your code.
Package codeartifactiface provides an interface to enable mocking the CodeArtifact service client for testing your code.
Package codebuild provides the client and types for making API requests to AWS CodeBuild.
Package codebuild provides the client and types for making API requests to AWS CodeBuild.
Package codebuildiface provides an interface to enable mocking the AWS CodeBuild service client for testing your code.
Package codebuildiface provides an interface to enable mocking the AWS CodeBuild service client for testing your code.
Package codecommit provides the client and types for making API requests to AWS CodeCommit.
Package codecommit provides the client and types for making API requests to AWS CodeCommit.
Package codecommitiface provides an interface to enable mocking the AWS CodeCommit service client for testing your code.
Package codecommitiface provides an interface to enable mocking the AWS CodeCommit service client for testing your code.
Package codedeploy provides the client and types for making API requests to AWS CodeDeploy.
Package codedeploy provides the client and types for making API requests to AWS CodeDeploy.
Package codedeployiface provides an interface to enable mocking the AWS CodeDeploy service client for testing your code.
Package codedeployiface provides an interface to enable mocking the AWS CodeDeploy service client for testing your code.
Package codeguruprofiler provides the client and types for making API requests to Amazon CodeGuru Profiler.
Package codeguruprofiler provides the client and types for making API requests to Amazon CodeGuru Profiler.
Package codeguruprofileriface provides an interface to enable mocking the Amazon CodeGuru Profiler service client for testing your code.
Package codeguruprofileriface provides an interface to enable mocking the Amazon CodeGuru Profiler service client for testing your code.
Package codegurureviewer provides the client and types for making API requests to Amazon CodeGuru Reviewer.
Package codegurureviewer provides the client and types for making API requests to Amazon CodeGuru Reviewer.
Package codegururevieweriface provides an interface to enable mocking the Amazon CodeGuru Reviewer service client for testing your code.
Package codegururevieweriface provides an interface to enable mocking the Amazon CodeGuru Reviewer service client for testing your code.
Package codepipeline provides the client and types for making API requests to AWS CodePipeline.
Package codepipeline provides the client and types for making API requests to AWS CodePipeline.
Package codepipelineiface provides an interface to enable mocking the AWS CodePipeline service client for testing your code.
Package codepipelineiface provides an interface to enable mocking the AWS CodePipeline service client for testing your code.
Package codestar provides the client and types for making API requests to AWS CodeStar.
Package codestar provides the client and types for making API requests to AWS CodeStar.
Package codestariface provides an interface to enable mocking the AWS CodeStar service client for testing your code.
Package codestariface provides an interface to enable mocking the AWS CodeStar service client for testing your code.
Package codestarconnections provides the client and types for making API requests to AWS CodeStar connections.
Package codestarconnections provides the client and types for making API requests to AWS CodeStar connections.
Package codestarconnectionsiface provides an interface to enable mocking the AWS CodeStar connections service client for testing your code.
Package codestarconnectionsiface provides an interface to enable mocking the AWS CodeStar connections service client for testing your code.
Package codestarnotifications provides the client and types for making API requests to AWS CodeStar Notifications.
Package codestarnotifications provides the client and types for making API requests to AWS CodeStar Notifications.
Package codestarnotificationsiface provides an interface to enable mocking the AWS CodeStar Notifications service client for testing your code.
Package codestarnotificationsiface provides an interface to enable mocking the AWS CodeStar Notifications service client for testing your code.
Package cognitoidentity provides the client and types for making API requests to Amazon Cognito Identity.
Package cognitoidentity provides the client and types for making API requests to Amazon Cognito Identity.
Package cognitoidentityiface provides an interface to enable mocking the Amazon Cognito Identity service client for testing your code.
Package cognitoidentityiface provides an interface to enable mocking the Amazon Cognito Identity service client for testing your code.
Package cognitoidentityprovider provides the client and types for making API requests to Amazon Cognito Identity Provider.
Package cognitoidentityprovider provides the client and types for making API requests to Amazon Cognito Identity Provider.
Package cognitoidentityprovideriface provides an interface to enable mocking the Amazon Cognito Identity Provider service client for testing your code.
Package cognitoidentityprovideriface provides an interface to enable mocking the Amazon Cognito Identity Provider service client for testing your code.
Package cognitosync provides the client and types for making API requests to Amazon Cognito Sync.
Package cognitosync provides the client and types for making API requests to Amazon Cognito Sync.
Package cognitosynciface provides an interface to enable mocking the Amazon Cognito Sync service client for testing your code.
Package cognitosynciface provides an interface to enable mocking the Amazon Cognito Sync service client for testing your code.
Package comprehend provides the client and types for making API requests to Amazon Comprehend.
Package comprehend provides the client and types for making API requests to Amazon Comprehend.
Package comprehendiface provides an interface to enable mocking the Amazon Comprehend service client for testing your code.
Package comprehendiface provides an interface to enable mocking the Amazon Comprehend service client for testing your code.
Package comprehendmedical provides the client and types for making API requests to AWS Comprehend Medical.
Package comprehendmedical provides the client and types for making API requests to AWS Comprehend Medical.
Package comprehendmedicaliface provides an interface to enable mocking the AWS Comprehend Medical service client for testing your code.
Package comprehendmedicaliface provides an interface to enable mocking the AWS Comprehend Medical service client for testing your code.
Package computeoptimizer provides the client and types for making API requests to AWS Compute Optimizer.
Package computeoptimizer provides the client and types for making API requests to AWS Compute Optimizer.
Package computeoptimizeriface provides an interface to enable mocking the AWS Compute Optimizer service client for testing your code.
Package computeoptimizeriface provides an interface to enable mocking the AWS Compute Optimizer service client for testing your code.
Package configservice provides the client and types for making API requests to AWS Config.
Package configservice provides the client and types for making API requests to AWS Config.
Package configserviceiface provides an interface to enable mocking the AWS Config service client for testing your code.
Package configserviceiface provides an interface to enable mocking the AWS Config service client for testing your code.
Package connect provides the client and types for making API requests to Amazon Connect Service.
Package connect provides the client and types for making API requests to Amazon Connect Service.
Package connectiface provides an interface to enable mocking the Amazon Connect Service service client for testing your code.
Package connectiface provides an interface to enable mocking the Amazon Connect Service service client for testing your code.
Package connectcontactlens provides the client and types for making API requests to Amazon Connect Contact Lens.
Package connectcontactlens provides the client and types for making API requests to Amazon Connect Contact Lens.
Package connectcontactlensiface provides an interface to enable mocking the Amazon Connect Contact Lens service client for testing your code.
Package connectcontactlensiface provides an interface to enable mocking the Amazon Connect Contact Lens service client for testing your code.
Package connectparticipant provides the client and types for making API requests to Amazon Connect Participant Service.
Package connectparticipant provides the client and types for making API requests to Amazon Connect Participant Service.
Package connectparticipantiface provides an interface to enable mocking the Amazon Connect Participant Service service client for testing your code.
Package connectparticipantiface provides an interface to enable mocking the Amazon Connect Participant Service service client for testing your code.
Package connectwisdomservice provides the client and types for making API requests to Amazon Connect Wisdom Service.
Package connectwisdomservice provides the client and types for making API requests to Amazon Connect Wisdom Service.
Package connectwisdomserviceiface provides an interface to enable mocking the Amazon Connect Wisdom Service service client for testing your code.
Package connectwisdomserviceiface provides an interface to enable mocking the Amazon Connect Wisdom Service service client for testing your code.
Package costandusagereportservice provides the client and types for making API requests to AWS Cost and Usage Report Service.
Package costandusagereportservice provides the client and types for making API requests to AWS Cost and Usage Report Service.
Package costandusagereportserviceiface provides an interface to enable mocking the AWS Cost and Usage Report Service service client for testing your code.
Package costandusagereportserviceiface provides an interface to enable mocking the AWS Cost and Usage Report Service service client for testing your code.
Package costexplorer provides the client and types for making API requests to AWS Cost Explorer Service.
Package costexplorer provides the client and types for making API requests to AWS Cost Explorer Service.
Package costexploreriface provides an interface to enable mocking the AWS Cost Explorer Service service client for testing your code.
Package costexploreriface provides an interface to enable mocking the AWS Cost Explorer Service service client for testing your code.
Package customerprofiles provides the client and types for making API requests to Amazon Connect Customer Profiles.
Package customerprofiles provides the client and types for making API requests to Amazon Connect Customer Profiles.
Package customerprofilesiface provides an interface to enable mocking the Amazon Connect Customer Profiles service client for testing your code.
Package customerprofilesiface provides an interface to enable mocking the Amazon Connect Customer Profiles service client for testing your code.
Package databasemigrationservice provides the client and types for making API requests to AWS Database Migration Service.
Package databasemigrationservice provides the client and types for making API requests to AWS Database Migration Service.
Package databasemigrationserviceiface provides an interface to enable mocking the AWS Database Migration Service service client for testing your code.
Package databasemigrationserviceiface provides an interface to enable mocking the AWS Database Migration Service service client for testing your code.
Package dataexchange provides the client and types for making API requests to AWS Data Exchange.
Package dataexchange provides the client and types for making API requests to AWS Data Exchange.
Package dataexchangeiface provides an interface to enable mocking the AWS Data Exchange service client for testing your code.
Package dataexchangeiface provides an interface to enable mocking the AWS Data Exchange service client for testing your code.
Package datapipeline provides the client and types for making API requests to AWS Data Pipeline.
Package datapipeline provides the client and types for making API requests to AWS Data Pipeline.
Package datapipelineiface provides an interface to enable mocking the AWS Data Pipeline service client for testing your code.
Package datapipelineiface provides an interface to enable mocking the AWS Data Pipeline service client for testing your code.
Package datasync provides the client and types for making API requests to AWS DataSync.
Package datasync provides the client and types for making API requests to AWS DataSync.
Package datasynciface provides an interface to enable mocking the AWS DataSync service client for testing your code.
Package datasynciface provides an interface to enable mocking the AWS DataSync service client for testing your code.
Package dax provides the client and types for making API requests to Amazon DynamoDB Accelerator (DAX).
Package dax provides the client and types for making API requests to Amazon DynamoDB Accelerator (DAX).
Package daxiface provides an interface to enable mocking the Amazon DynamoDB Accelerator (DAX) service client for testing your code.
Package daxiface provides an interface to enable mocking the Amazon DynamoDB Accelerator (DAX) service client for testing your code.
Package detective provides the client and types for making API requests to Amazon Detective.
Package detective provides the client and types for making API requests to Amazon Detective.
Package detectiveiface provides an interface to enable mocking the Amazon Detective service client for testing your code.
Package detectiveiface provides an interface to enable mocking the Amazon Detective service client for testing your code.
Package devicefarm provides the client and types for making API requests to AWS Device Farm.
Package devicefarm provides the client and types for making API requests to AWS Device Farm.
Package devicefarmiface provides an interface to enable mocking the AWS Device Farm service client for testing your code.
Package devicefarmiface provides an interface to enable mocking the AWS Device Farm service client for testing your code.
Package devopsguru provides the client and types for making API requests to Amazon DevOps Guru.
Package devopsguru provides the client and types for making API requests to Amazon DevOps Guru.
Package devopsguruiface provides an interface to enable mocking the Amazon DevOps Guru service client for testing your code.
Package devopsguruiface provides an interface to enable mocking the Amazon DevOps Guru service client for testing your code.
Package directconnect provides the client and types for making API requests to AWS Direct Connect.
Package directconnect provides the client and types for making API requests to AWS Direct Connect.
Package directconnectiface provides an interface to enable mocking the AWS Direct Connect service client for testing your code.
Package directconnectiface provides an interface to enable mocking the AWS Direct Connect service client for testing your code.
Package directoryservice provides the client and types for making API requests to AWS Directory Service.
Package directoryservice provides the client and types for making API requests to AWS Directory Service.
Package directoryserviceiface provides an interface to enable mocking the AWS Directory Service service client for testing your code.
Package directoryserviceiface provides an interface to enable mocking the AWS Directory Service service client for testing your code.
Package dlm provides the client and types for making API requests to Amazon Data Lifecycle Manager.
Package dlm provides the client and types for making API requests to Amazon Data Lifecycle Manager.
Package dlmiface provides an interface to enable mocking the Amazon Data Lifecycle Manager service client for testing your code.
Package dlmiface provides an interface to enable mocking the Amazon Data Lifecycle Manager service client for testing your code.
Package docdb provides the client and types for making API requests to Amazon DocumentDB with MongoDB compatibility.
Package docdb provides the client and types for making API requests to Amazon DocumentDB with MongoDB compatibility.
Package docdbiface provides an interface to enable mocking the Amazon DocumentDB with MongoDB compatibility service client for testing your code.
Package docdbiface provides an interface to enable mocking the Amazon DocumentDB with MongoDB compatibility service client for testing your code.
Package drs provides the client and types for making API requests to Elastic Disaster Recovery Service.
Package drs provides the client and types for making API requests to Elastic Disaster Recovery Service.
Package drsiface provides an interface to enable mocking the Elastic Disaster Recovery Service service client for testing your code.
Package drsiface provides an interface to enable mocking the Elastic Disaster Recovery Service service client for testing your code.
Package dynamodb provides the client and types for making API requests to Amazon DynamoDB.
Package dynamodb provides the client and types for making API requests to Amazon DynamoDB.
Package dynamodbattribute provides marshaling and unmarshaling utilities to convert between Go types and dynamodb.AttributeValues.
Package dynamodbattribute provides marshaling and unmarshaling utilities to convert between Go types and dynamodb.AttributeValues.
Package dynamodbiface provides an interface to enable mocking the Amazon DynamoDB service client for testing your code.
Package dynamodbiface provides an interface to enable mocking the Amazon DynamoDB service client for testing your code.
Package expression provides types and functions to create Amazon DynamoDB Expression strings, ExpressionAttributeNames maps, and ExpressionAttributeValues maps.
Package expression provides types and functions to create Amazon DynamoDB Expression strings, ExpressionAttributeNames maps, and ExpressionAttributeValues maps.
Package dynamodbstreams provides the client and types for making API requests to Amazon DynamoDB Streams.
Package dynamodbstreams provides the client and types for making API requests to Amazon DynamoDB Streams.
Package dynamodbstreamsiface provides an interface to enable mocking the Amazon DynamoDB Streams service client for testing your code.
Package dynamodbstreamsiface provides an interface to enable mocking the Amazon DynamoDB Streams service client for testing your code.
Package ebs provides the client and types for making API requests to Amazon Elastic Block Store.
Package ebs provides the client and types for making API requests to Amazon Elastic Block Store.
Package ebsiface provides an interface to enable mocking the Amazon Elastic Block Store service client for testing your code.
Package ebsiface provides an interface to enable mocking the Amazon Elastic Block Store service client for testing your code.
Package ec2 provides the client and types for making API requests to Amazon Elastic Compute Cloud.
Package ec2 provides the client and types for making API requests to Amazon Elastic Compute Cloud.
Package ec2iface provides an interface to enable mocking the Amazon Elastic Compute Cloud service client for testing your code.
Package ec2iface provides an interface to enable mocking the Amazon Elastic Compute Cloud service client for testing your code.
Package ec2instanceconnect provides the client and types for making API requests to AWS EC2 Instance Connect.
Package ec2instanceconnect provides the client and types for making API requests to AWS EC2 Instance Connect.
Package ec2instanceconnectiface provides an interface to enable mocking the AWS EC2 Instance Connect service client for testing your code.
Package ec2instanceconnectiface provides an interface to enable mocking the AWS EC2 Instance Connect service client for testing your code.
Package ecr provides the client and types for making API requests to Amazon EC2 Container Registry.
Package ecr provides the client and types for making API requests to Amazon EC2 Container Registry.
Package ecriface provides an interface to enable mocking the Amazon EC2 Container Registry service client for testing your code.
Package ecriface provides an interface to enable mocking the Amazon EC2 Container Registry service client for testing your code.
Package ecrpublic provides the client and types for making API requests to Amazon Elastic Container Registry Public.
Package ecrpublic provides the client and types for making API requests to Amazon Elastic Container Registry Public.
Package ecrpubliciface provides an interface to enable mocking the Amazon Elastic Container Registry Public service client for testing your code.
Package ecrpubliciface provides an interface to enable mocking the Amazon Elastic Container Registry Public service client for testing your code.
Package ecs provides the client and types for making API requests to Amazon EC2 Container Service.
Package ecs provides the client and types for making API requests to Amazon EC2 Container Service.
Package ecsiface provides an interface to enable mocking the Amazon EC2 Container Service service client for testing your code.
Package ecsiface provides an interface to enable mocking the Amazon EC2 Container Service service client for testing your code.
Package efs provides the client and types for making API requests to Amazon Elastic File System.
Package efs provides the client and types for making API requests to Amazon Elastic File System.
Package efsiface provides an interface to enable mocking the Amazon Elastic File System service client for testing your code.
Package efsiface provides an interface to enable mocking the Amazon Elastic File System service client for testing your code.
Package eks provides the client and types for making API requests to Amazon Elastic Kubernetes Service.
Package eks provides the client and types for making API requests to Amazon Elastic Kubernetes Service.
Package eksiface provides an interface to enable mocking the Amazon Elastic Kubernetes Service service client for testing your code.
Package eksiface provides an interface to enable mocking the Amazon Elastic Kubernetes Service service client for testing your code.
Package elasticache provides the client and types for making API requests to Amazon ElastiCache.
Package elasticache provides the client and types for making API requests to Amazon ElastiCache.
Package elasticacheiface provides an interface to enable mocking the Amazon ElastiCache service client for testing your code.
Package elasticacheiface provides an interface to enable mocking the Amazon ElastiCache service client for testing your code.
Package elasticbeanstalk provides the client and types for making API requests to AWS Elastic Beanstalk.
Package elasticbeanstalk provides the client and types for making API requests to AWS Elastic Beanstalk.
Package elasticbeanstalkiface provides an interface to enable mocking the AWS Elastic Beanstalk service client for testing your code.
Package elasticbeanstalkiface provides an interface to enable mocking the AWS Elastic Beanstalk service client for testing your code.
Package elasticinference provides the client and types for making API requests to Amazon Elastic Inference.
Package elasticinference provides the client and types for making API requests to Amazon Elastic Inference.
Package elasticinferenceiface provides an interface to enable mocking the Amazon Elastic Inference service client for testing your code.
Package elasticinferenceiface provides an interface to enable mocking the Amazon Elastic Inference service client for testing your code.
Package elasticsearchservice provides the client and types for making API requests to Amazon Elasticsearch Service.
Package elasticsearchservice provides the client and types for making API requests to Amazon Elasticsearch Service.
Package elasticsearchserviceiface provides an interface to enable mocking the Amazon Elasticsearch Service service client for testing your code.
Package elasticsearchserviceiface provides an interface to enable mocking the Amazon Elasticsearch Service service client for testing your code.
Package elastictranscoder provides the client and types for making API requests to Amazon Elastic Transcoder.
Package elastictranscoder provides the client and types for making API requests to Amazon Elastic Transcoder.
Package elastictranscoderiface provides an interface to enable mocking the Amazon Elastic Transcoder service client for testing your code.
Package elastictranscoderiface provides an interface to enable mocking the Amazon Elastic Transcoder service client for testing your code.
Package elb provides the client and types for making API requests to Elastic Load Balancing.
Package elb provides the client and types for making API requests to Elastic Load Balancing.
Package elbiface provides an interface to enable mocking the Elastic Load Balancing service client for testing your code.
Package elbiface provides an interface to enable mocking the Elastic Load Balancing service client for testing your code.
Package elbv2 provides the client and types for making API requests to Elastic Load Balancing.
Package elbv2 provides the client and types for making API requests to Elastic Load Balancing.
Package elbv2iface provides an interface to enable mocking the Elastic Load Balancing service client for testing your code.
Package elbv2iface provides an interface to enable mocking the Elastic Load Balancing service client for testing your code.
Package emr provides the client and types for making API requests to Amazon EMR.
Package emr provides the client and types for making API requests to Amazon EMR.
Package emriface provides an interface to enable mocking the Amazon EMR service client for testing your code.
Package emriface provides an interface to enable mocking the Amazon EMR service client for testing your code.
Package emrcontainers provides the client and types for making API requests to Amazon EMR Containers.
Package emrcontainers provides the client and types for making API requests to Amazon EMR Containers.
Package emrcontainersiface provides an interface to enable mocking the Amazon EMR Containers service client for testing your code.
Package emrcontainersiface provides an interface to enable mocking the Amazon EMR Containers service client for testing your code.
Package eventbridge provides the client and types for making API requests to Amazon EventBridge.
Package eventbridge provides the client and types for making API requests to Amazon EventBridge.
Package eventbridgeiface provides an interface to enable mocking the Amazon EventBridge service client for testing your code.
Package eventbridgeiface provides an interface to enable mocking the Amazon EventBridge service client for testing your code.
Package finspace provides the client and types for making API requests to FinSpace User Environment Management service.
Package finspace provides the client and types for making API requests to FinSpace User Environment Management service.
Package finspaceiface provides an interface to enable mocking the FinSpace User Environment Management service service client for testing your code.
Package finspaceiface provides an interface to enable mocking the FinSpace User Environment Management service service client for testing your code.
Package finspacedata provides the client and types for making API requests to FinSpace Public API.
Package finspacedata provides the client and types for making API requests to FinSpace Public API.
Package finspacedataiface provides an interface to enable mocking the FinSpace Public API service client for testing your code.
Package finspacedataiface provides an interface to enable mocking the FinSpace Public API service client for testing your code.
Package firehose provides the client and types for making API requests to Amazon Kinesis Firehose.
Package firehose provides the client and types for making API requests to Amazon Kinesis Firehose.
Package firehoseiface provides an interface to enable mocking the Amazon Kinesis Firehose service client for testing your code.
Package firehoseiface provides an interface to enable mocking the Amazon Kinesis Firehose service client for testing your code.
Package fis provides the client and types for making API requests to AWS Fault Injection Simulator.
Package fis provides the client and types for making API requests to AWS Fault Injection Simulator.
Package fisiface provides an interface to enable mocking the AWS Fault Injection Simulator service client for testing your code.
Package fisiface provides an interface to enable mocking the AWS Fault Injection Simulator service client for testing your code.
Package fms provides the client and types for making API requests to Firewall Management Service.
Package fms provides the client and types for making API requests to Firewall Management Service.
Package fmsiface provides an interface to enable mocking the Firewall Management Service service client for testing your code.
Package fmsiface provides an interface to enable mocking the Firewall Management Service service client for testing your code.
Package forecastqueryservice provides the client and types for making API requests to Amazon Forecast Query Service.
Package forecastqueryservice provides the client and types for making API requests to Amazon Forecast Query Service.
Package forecastqueryserviceiface provides an interface to enable mocking the Amazon Forecast Query Service service client for testing your code.
Package forecastqueryserviceiface provides an interface to enable mocking the Amazon Forecast Query Service service client for testing your code.
Package forecastservice provides the client and types for making API requests to Amazon Forecast Service.
Package forecastservice provides the client and types for making API requests to Amazon Forecast Service.
Package forecastserviceiface provides an interface to enable mocking the Amazon Forecast Service service client for testing your code.
Package forecastserviceiface provides an interface to enable mocking the Amazon Forecast Service service client for testing your code.
Package frauddetector provides the client and types for making API requests to Amazon Fraud Detector.
Package frauddetector provides the client and types for making API requests to Amazon Fraud Detector.
Package frauddetectoriface provides an interface to enable mocking the Amazon Fraud Detector service client for testing your code.
Package frauddetectoriface provides an interface to enable mocking the Amazon Fraud Detector service client for testing your code.
Package fsx provides the client and types for making API requests to Amazon FSx.
Package fsx provides the client and types for making API requests to Amazon FSx.
Package fsxiface provides an interface to enable mocking the Amazon FSx service client for testing your code.
Package fsxiface provides an interface to enable mocking the Amazon FSx service client for testing your code.
Package gamelift provides the client and types for making API requests to Amazon GameLift.
Package gamelift provides the client and types for making API requests to Amazon GameLift.
Package gameliftiface provides an interface to enable mocking the Amazon GameLift service client for testing your code.
Package gameliftiface provides an interface to enable mocking the Amazon GameLift service client for testing your code.
Package gamesparks provides the client and types for making API requests to GameSparks.
Package gamesparks provides the client and types for making API requests to GameSparks.
Package gamesparksiface provides an interface to enable mocking the GameSparks service client for testing your code.
Package gamesparksiface provides an interface to enable mocking the GameSparks service client for testing your code.
Package glacier provides the client and types for making API requests to Amazon Glacier.
Package glacier provides the client and types for making API requests to Amazon Glacier.
Package glacieriface provides an interface to enable mocking the Amazon Glacier service client for testing your code.
Package glacieriface provides an interface to enable mocking the Amazon Glacier service client for testing your code.
Package globalaccelerator provides the client and types for making API requests to AWS Global Accelerator.
Package globalaccelerator provides the client and types for making API requests to AWS Global Accelerator.
Package globalacceleratoriface provides an interface to enable mocking the AWS Global Accelerator service client for testing your code.
Package globalacceleratoriface provides an interface to enable mocking the AWS Global Accelerator service client for testing your code.
Package glue provides the client and types for making API requests to AWS Glue.
Package glue provides the client and types for making API requests to AWS Glue.
Package glueiface provides an interface to enable mocking the AWS Glue service client for testing your code.
Package glueiface provides an interface to enable mocking the AWS Glue service client for testing your code.
Package gluedatabrew provides the client and types for making API requests to AWS Glue DataBrew.
Package gluedatabrew provides the client and types for making API requests to AWS Glue DataBrew.
Package gluedatabrewiface provides an interface to enable mocking the AWS Glue DataBrew service client for testing your code.
Package gluedatabrewiface provides an interface to enable mocking the AWS Glue DataBrew service client for testing your code.
Package greengrass provides the client and types for making API requests to AWS Greengrass.
Package greengrass provides the client and types for making API requests to AWS Greengrass.
Package greengrassiface provides an interface to enable mocking the AWS Greengrass service client for testing your code.
Package greengrassiface provides an interface to enable mocking the AWS Greengrass service client for testing your code.
Package greengrassv2 provides the client and types for making API requests to AWS IoT Greengrass V2.
Package greengrassv2 provides the client and types for making API requests to AWS IoT Greengrass V2.
Package greengrassv2iface provides an interface to enable mocking the AWS IoT Greengrass V2 service client for testing your code.
Package greengrassv2iface provides an interface to enable mocking the AWS IoT Greengrass V2 service client for testing your code.
Package groundstation provides the client and types for making API requests to AWS Ground Station.
Package groundstation provides the client and types for making API requests to AWS Ground Station.
Package groundstationiface provides an interface to enable mocking the AWS Ground Station service client for testing your code.
Package groundstationiface provides an interface to enable mocking the AWS Ground Station service client for testing your code.
Package guardduty provides the client and types for making API requests to Amazon GuardDuty.
Package guardduty provides the client and types for making API requests to Amazon GuardDuty.
Package guarddutyiface provides an interface to enable mocking the Amazon GuardDuty service client for testing your code.
Package guarddutyiface provides an interface to enable mocking the Amazon GuardDuty service client for testing your code.
Package health provides the client and types for making API requests to AWS Health APIs and Notifications.
Package health provides the client and types for making API requests to AWS Health APIs and Notifications.
Package healthiface provides an interface to enable mocking the AWS Health APIs and Notifications service client for testing your code.
Package healthiface provides an interface to enable mocking the AWS Health APIs and Notifications service client for testing your code.
Package healthlake provides the client and types for making API requests to Amazon HealthLake.
Package healthlake provides the client and types for making API requests to Amazon HealthLake.
Package healthlakeiface provides an interface to enable mocking the Amazon HealthLake service client for testing your code.
Package healthlakeiface provides an interface to enable mocking the Amazon HealthLake service client for testing your code.
Package honeycode provides the client and types for making API requests to Amazon Honeycode.
Package honeycode provides the client and types for making API requests to Amazon Honeycode.
Package honeycodeiface provides an interface to enable mocking the Amazon Honeycode service client for testing your code.
Package honeycodeiface provides an interface to enable mocking the Amazon Honeycode service client for testing your code.
Package iam provides the client and types for making API requests to AWS Identity and Access Management.
Package iam provides the client and types for making API requests to AWS Identity and Access Management.
Package iamiface provides an interface to enable mocking the AWS Identity and Access Management service client for testing your code.
Package iamiface provides an interface to enable mocking the AWS Identity and Access Management service client for testing your code.
Package identitystore provides the client and types for making API requests to AWS SSO Identity Store.
Package identitystore provides the client and types for making API requests to AWS SSO Identity Store.
Package identitystoreiface provides an interface to enable mocking the AWS SSO Identity Store service client for testing your code.
Package identitystoreiface provides an interface to enable mocking the AWS SSO Identity Store service client for testing your code.
Package imagebuilder provides the client and types for making API requests to EC2 Image Builder.
Package imagebuilder provides the client and types for making API requests to EC2 Image Builder.
Package imagebuilderiface provides an interface to enable mocking the EC2 Image Builder service client for testing your code.
Package imagebuilderiface provides an interface to enable mocking the EC2 Image Builder service client for testing your code.
Package inspector provides the client and types for making API requests to Amazon Inspector.
Package inspector provides the client and types for making API requests to Amazon Inspector.
Package inspectoriface provides an interface to enable mocking the Amazon Inspector service client for testing your code.
Package inspectoriface provides an interface to enable mocking the Amazon Inspector service client for testing your code.
Package inspector2 provides the client and types for making API requests to Inspector2.
Package inspector2 provides the client and types for making API requests to Inspector2.
Package inspector2iface provides an interface to enable mocking the Inspector2 service client for testing your code.
Package inspector2iface provides an interface to enable mocking the Inspector2 service client for testing your code.
Package iot provides the client and types for making API requests to AWS IoT. IoT provides secure, bi-directional communication between Internet-connected devices (such as sensors, actuators, embedded devices, or smart appliances) and the Amazon Web Services cloud.
Package iot provides the client and types for making API requests to AWS IoT. IoT provides secure, bi-directional communication between Internet-connected devices (such as sensors, actuators, embedded devices, or smart appliances) and the Amazon Web Services cloud.
Package iotiface provides an interface to enable mocking the AWS IoT service client for testing your code.
Package iotiface provides an interface to enable mocking the AWS IoT service client for testing your code.
Package iot1clickdevicesservice provides the client and types for making API requests to AWS IoT 1-Click Devices Service.
Package iot1clickdevicesservice provides the client and types for making API requests to AWS IoT 1-Click Devices Service.
Package iot1clickdevicesserviceiface provides an interface to enable mocking the AWS IoT 1-Click Devices Service service client for testing your code.
Package iot1clickdevicesserviceiface provides an interface to enable mocking the AWS IoT 1-Click Devices Service service client for testing your code.
Package iot1clickprojects provides the client and types for making API requests to AWS IoT 1-Click Projects Service.
Package iot1clickprojects provides the client and types for making API requests to AWS IoT 1-Click Projects Service.
Package iot1clickprojectsiface provides an interface to enable mocking the AWS IoT 1-Click Projects Service service client for testing your code.
Package iot1clickprojectsiface provides an interface to enable mocking the AWS IoT 1-Click Projects Service service client for testing your code.
Package iotanalytics provides the client and types for making API requests to AWS IoT Analytics.
Package iotanalytics provides the client and types for making API requests to AWS IoT Analytics.
Package iotanalyticsiface provides an interface to enable mocking the AWS IoT Analytics service client for testing your code.
Package iotanalyticsiface provides an interface to enable mocking the AWS IoT Analytics service client for testing your code.
Package iotdataplane provides the client and types for making API requests to AWS IoT Data Plane.
Package iotdataplane provides the client and types for making API requests to AWS IoT Data Plane.
Package iotdataplaneiface provides an interface to enable mocking the AWS IoT Data Plane service client for testing your code.
Package iotdataplaneiface provides an interface to enable mocking the AWS IoT Data Plane service client for testing your code.
Package iotdeviceadvisor provides the client and types for making API requests to AWS IoT Core Device Advisor.
Package iotdeviceadvisor provides the client and types for making API requests to AWS IoT Core Device Advisor.
Package iotdeviceadvisoriface provides an interface to enable mocking the AWS IoT Core Device Advisor service client for testing your code.
Package iotdeviceadvisoriface provides an interface to enable mocking the AWS IoT Core Device Advisor service client for testing your code.
Package iotevents provides the client and types for making API requests to AWS IoT Events.
Package iotevents provides the client and types for making API requests to AWS IoT Events.
Package ioteventsiface provides an interface to enable mocking the AWS IoT Events service client for testing your code.
Package ioteventsiface provides an interface to enable mocking the AWS IoT Events service client for testing your code.
Package ioteventsdata provides the client and types for making API requests to AWS IoT Events Data.
Package ioteventsdata provides the client and types for making API requests to AWS IoT Events Data.
Package ioteventsdataiface provides an interface to enable mocking the AWS IoT Events Data service client for testing your code.
Package ioteventsdataiface provides an interface to enable mocking the AWS IoT Events Data service client for testing your code.
Package iotfleethub provides the client and types for making API requests to AWS IoT Fleet Hub.
Package iotfleethub provides the client and types for making API requests to AWS IoT Fleet Hub.
Package iotfleethubiface provides an interface to enable mocking the AWS IoT Fleet Hub service client for testing your code.
Package iotfleethubiface provides an interface to enable mocking the AWS IoT Fleet Hub service client for testing your code.
Package iotjobsdataplane provides the client and types for making API requests to AWS IoT Jobs Data Plane.
Package iotjobsdataplane provides the client and types for making API requests to AWS IoT Jobs Data Plane.
Package iotjobsdataplaneiface provides an interface to enable mocking the AWS IoT Jobs Data Plane service client for testing your code.
Package iotjobsdataplaneiface provides an interface to enable mocking the AWS IoT Jobs Data Plane service client for testing your code.
Package iotsecuretunneling provides the client and types for making API requests to AWS IoT Secure Tunneling.
Package iotsecuretunneling provides the client and types for making API requests to AWS IoT Secure Tunneling.
Package iotsecuretunnelingiface provides an interface to enable mocking the AWS IoT Secure Tunneling service client for testing your code.
Package iotsecuretunnelingiface provides an interface to enable mocking the AWS IoT Secure Tunneling service client for testing your code.
Package iotsitewise provides the client and types for making API requests to AWS IoT SiteWise.
Package iotsitewise provides the client and types for making API requests to AWS IoT SiteWise.
Package iotsitewiseiface provides an interface to enable mocking the AWS IoT SiteWise service client for testing your code.
Package iotsitewiseiface provides an interface to enable mocking the AWS IoT SiteWise service client for testing your code.
Package iotthingsgraph provides the client and types for making API requests to AWS IoT Things Graph.
Package iotthingsgraph provides the client and types for making API requests to AWS IoT Things Graph.
Package iotthingsgraphiface provides an interface to enable mocking the AWS IoT Things Graph service client for testing your code.
Package iotthingsgraphiface provides an interface to enable mocking the AWS IoT Things Graph service client for testing your code.
Package iottwinmaker provides the client and types for making API requests to AWS IoT TwinMaker.
Package iottwinmaker provides the client and types for making API requests to AWS IoT TwinMaker.
Package iottwinmakeriface provides an interface to enable mocking the AWS IoT TwinMaker service client for testing your code.
Package iottwinmakeriface provides an interface to enable mocking the AWS IoT TwinMaker service client for testing your code.
Package iotwireless provides the client and types for making API requests to AWS IoT Wireless.
Package iotwireless provides the client and types for making API requests to AWS IoT Wireless.
Package iotwirelessiface provides an interface to enable mocking the AWS IoT Wireless service client for testing your code.
Package iotwirelessiface provides an interface to enable mocking the AWS IoT Wireless service client for testing your code.
Package ivs provides the client and types for making API requests to Amazon Interactive Video Service.
Package ivs provides the client and types for making API requests to Amazon Interactive Video Service.
Package ivsiface provides an interface to enable mocking the Amazon Interactive Video Service service client for testing your code.
Package ivsiface provides an interface to enable mocking the Amazon Interactive Video Service service client for testing your code.
Package ivschat provides the client and types for making API requests to Amazon Interactive Video Service Chat.
Package ivschat provides the client and types for making API requests to Amazon Interactive Video Service Chat.
Package ivschatiface provides an interface to enable mocking the Amazon Interactive Video Service Chat service client for testing your code.
Package ivschatiface provides an interface to enable mocking the Amazon Interactive Video Service Chat service client for testing your code.
Package kafka provides the client and types for making API requests to Managed Streaming for Kafka.
Package kafka provides the client and types for making API requests to Managed Streaming for Kafka.
Package kafkaiface provides an interface to enable mocking the Managed Streaming for Kafka service client for testing your code.
Package kafkaiface provides an interface to enable mocking the Managed Streaming for Kafka service client for testing your code.
Package kafkaconnect provides the client and types for making API requests to Managed Streaming for Kafka Connect.
Package kafkaconnect provides the client and types for making API requests to Managed Streaming for Kafka Connect.
Package kafkaconnectiface provides an interface to enable mocking the Managed Streaming for Kafka Connect service client for testing your code.
Package kafkaconnectiface provides an interface to enable mocking the Managed Streaming for Kafka Connect service client for testing your code.
Package kendra provides the client and types for making API requests to AWSKendraFrontendService.
Package kendra provides the client and types for making API requests to AWSKendraFrontendService.
Package kendraiface provides an interface to enable mocking the AWSKendraFrontendService service client for testing your code.
Package kendraiface provides an interface to enable mocking the AWSKendraFrontendService service client for testing your code.
Package keyspaces provides the client and types for making API requests to Amazon Keyspaces.
Package keyspaces provides the client and types for making API requests to Amazon Keyspaces.
Package keyspacesiface provides an interface to enable mocking the Amazon Keyspaces service client for testing your code.
Package keyspacesiface provides an interface to enable mocking the Amazon Keyspaces service client for testing your code.
Package kinesis provides the client and types for making API requests to Amazon Kinesis.
Package kinesis provides the client and types for making API requests to Amazon Kinesis.
Package kinesisiface provides an interface to enable mocking the Amazon Kinesis service client for testing your code.
Package kinesisiface provides an interface to enable mocking the Amazon Kinesis service client for testing your code.
Package kinesisanalytics provides the client and types for making API requests to Amazon Kinesis Analytics.
Package kinesisanalytics provides the client and types for making API requests to Amazon Kinesis Analytics.
Package kinesisanalyticsiface provides an interface to enable mocking the Amazon Kinesis Analytics service client for testing your code.
Package kinesisanalyticsiface provides an interface to enable mocking the Amazon Kinesis Analytics service client for testing your code.
Package kinesisanalyticsv2 provides the client and types for making API requests to Amazon Kinesis Analytics.
Package kinesisanalyticsv2 provides the client and types for making API requests to Amazon Kinesis Analytics.
Package kinesisanalyticsv2iface provides an interface to enable mocking the Amazon Kinesis Analytics service client for testing your code.
Package kinesisanalyticsv2iface provides an interface to enable mocking the Amazon Kinesis Analytics service client for testing your code.
Package kinesisvideo provides the client and types for making API requests to Amazon Kinesis Video Streams.
Package kinesisvideo provides the client and types for making API requests to Amazon Kinesis Video Streams.
Package kinesisvideoiface provides an interface to enable mocking the Amazon Kinesis Video Streams service client for testing your code.
Package kinesisvideoiface provides an interface to enable mocking the Amazon Kinesis Video Streams service client for testing your code.
Package kinesisvideoarchivedmedia provides the client and types for making API requests to Amazon Kinesis Video Streams Archived Media.
Package kinesisvideoarchivedmedia provides the client and types for making API requests to Amazon Kinesis Video Streams Archived Media.
Package kinesisvideoarchivedmediaiface provides an interface to enable mocking the Amazon Kinesis Video Streams Archived Media service client for testing your code.
Package kinesisvideoarchivedmediaiface provides an interface to enable mocking the Amazon Kinesis Video Streams Archived Media service client for testing your code.
Package kinesisvideomedia provides the client and types for making API requests to Amazon Kinesis Video Streams Media.
Package kinesisvideomedia provides the client and types for making API requests to Amazon Kinesis Video Streams Media.
Package kinesisvideomediaiface provides an interface to enable mocking the Amazon Kinesis Video Streams Media service client for testing your code.
Package kinesisvideomediaiface provides an interface to enable mocking the Amazon Kinesis Video Streams Media service client for testing your code.
Package kinesisvideosignalingchannels provides the client and types for making API requests to Amazon Kinesis Video Signaling Channels.
Package kinesisvideosignalingchannels provides the client and types for making API requests to Amazon Kinesis Video Signaling Channels.
Package kinesisvideosignalingchannelsiface provides an interface to enable mocking the Amazon Kinesis Video Signaling Channels service client for testing your code.
Package kinesisvideosignalingchannelsiface provides an interface to enable mocking the Amazon Kinesis Video Signaling Channels service client for testing your code.
Package kms provides the client and types for making API requests to AWS Key Management Service.
Package kms provides the client and types for making API requests to AWS Key Management Service.
Package kmsiface provides an interface to enable mocking the AWS Key Management Service service client for testing your code.
Package kmsiface provides an interface to enable mocking the AWS Key Management Service service client for testing your code.
Package lakeformation provides the client and types for making API requests to AWS Lake Formation.
Package lakeformation provides the client and types for making API requests to AWS Lake Formation.
Package lakeformationiface provides an interface to enable mocking the AWS Lake Formation service client for testing your code.
Package lakeformationiface provides an interface to enable mocking the AWS Lake Formation service client for testing your code.
Package lambda provides the client and types for making API requests to AWS Lambda.
Package lambda provides the client and types for making API requests to AWS Lambda.
Package lambdaiface provides an interface to enable mocking the AWS Lambda service client for testing your code.
Package lambdaiface provides an interface to enable mocking the AWS Lambda service client for testing your code.
Package lexmodelbuildingservice provides the client and types for making API requests to Amazon Lex Model Building Service.
Package lexmodelbuildingservice provides the client and types for making API requests to Amazon Lex Model Building Service.
Package lexmodelbuildingserviceiface provides an interface to enable mocking the Amazon Lex Model Building Service service client for testing your code.
Package lexmodelbuildingserviceiface provides an interface to enable mocking the Amazon Lex Model Building Service service client for testing your code.
Package lexmodelsv2 provides the client and types for making API requests to Amazon Lex Model Building V2.
Package lexmodelsv2 provides the client and types for making API requests to Amazon Lex Model Building V2.
Package lexmodelsv2iface provides an interface to enable mocking the Amazon Lex Model Building V2 service client for testing your code.
Package lexmodelsv2iface provides an interface to enable mocking the Amazon Lex Model Building V2 service client for testing your code.
Package lexruntimeservice provides the client and types for making API requests to Amazon Lex Runtime Service.
Package lexruntimeservice provides the client and types for making API requests to Amazon Lex Runtime Service.
Package lexruntimeserviceiface provides an interface to enable mocking the Amazon Lex Runtime Service service client for testing your code.
Package lexruntimeserviceiface provides an interface to enable mocking the Amazon Lex Runtime Service service client for testing your code.
Package lexruntimev2 provides the client and types for making API requests to Amazon Lex Runtime V2.
Package lexruntimev2 provides the client and types for making API requests to Amazon Lex Runtime V2.
Package lexruntimev2iface provides an interface to enable mocking the Amazon Lex Runtime V2 service client for testing your code.
Package lexruntimev2iface provides an interface to enable mocking the Amazon Lex Runtime V2 service client for testing your code.
Package licensemanager provides the client and types for making API requests to AWS License Manager.
Package licensemanager provides the client and types for making API requests to AWS License Manager.
Package licensemanageriface provides an interface to enable mocking the AWS License Manager service client for testing your code.
Package licensemanageriface provides an interface to enable mocking the AWS License Manager service client for testing your code.
Package lightsail provides the client and types for making API requests to Amazon Lightsail.
Package lightsail provides the client and types for making API requests to Amazon Lightsail.
Package lightsailiface provides an interface to enable mocking the Amazon Lightsail service client for testing your code.
Package lightsailiface provides an interface to enable mocking the Amazon Lightsail service client for testing your code.
Package locationservice provides the client and types for making API requests to Amazon Location Service.
Package locationservice provides the client and types for making API requests to Amazon Location Service.
Package locationserviceiface provides an interface to enable mocking the Amazon Location Service service client for testing your code.
Package locationserviceiface provides an interface to enable mocking the Amazon Location Service service client for testing your code.
Package lookoutequipment provides the client and types for making API requests to Amazon Lookout for Equipment.
Package lookoutequipment provides the client and types for making API requests to Amazon Lookout for Equipment.
Package lookoutequipmentiface provides an interface to enable mocking the Amazon Lookout for Equipment service client for testing your code.
Package lookoutequipmentiface provides an interface to enable mocking the Amazon Lookout for Equipment service client for testing your code.
Package lookoutforvision provides the client and types for making API requests to Amazon Lookout for Vision.
Package lookoutforvision provides the client and types for making API requests to Amazon Lookout for Vision.
Package lookoutforvisioniface provides an interface to enable mocking the Amazon Lookout for Vision service client for testing your code.
Package lookoutforvisioniface provides an interface to enable mocking the Amazon Lookout for Vision service client for testing your code.
Package lookoutmetrics provides the client and types for making API requests to Amazon Lookout for Metrics.
Package lookoutmetrics provides the client and types for making API requests to Amazon Lookout for Metrics.
Package lookoutmetricsiface provides an interface to enable mocking the Amazon Lookout for Metrics service client for testing your code.
Package lookoutmetricsiface provides an interface to enable mocking the Amazon Lookout for Metrics service client for testing your code.
Package machinelearning provides the client and types for making API requests to Amazon Machine Learning.
Package machinelearning provides the client and types for making API requests to Amazon Machine Learning.
Package machinelearningiface provides an interface to enable mocking the Amazon Machine Learning service client for testing your code.
Package machinelearningiface provides an interface to enable mocking the Amazon Machine Learning service client for testing your code.
Package macie provides the client and types for making API requests to Amazon Macie.
Package macie provides the client and types for making API requests to Amazon Macie.
Package macieiface provides an interface to enable mocking the Amazon Macie service client for testing your code.
Package macieiface provides an interface to enable mocking the Amazon Macie service client for testing your code.
Package macie2 provides the client and types for making API requests to Amazon Macie 2.
Package macie2 provides the client and types for making API requests to Amazon Macie 2.
Package macie2iface provides an interface to enable mocking the Amazon Macie 2 service client for testing your code.
Package macie2iface provides an interface to enable mocking the Amazon Macie 2 service client for testing your code.
Package managedblockchain provides the client and types for making API requests to Amazon Managed Blockchain.
Package managedblockchain provides the client and types for making API requests to Amazon Managed Blockchain.
Package managedblockchainiface provides an interface to enable mocking the Amazon Managed Blockchain service client for testing your code.
Package managedblockchainiface provides an interface to enable mocking the Amazon Managed Blockchain service client for testing your code.
Package managedgrafana provides the client and types for making API requests to Amazon Managed Grafana.
Package managedgrafana provides the client and types for making API requests to Amazon Managed Grafana.
Package managedgrafanaiface provides an interface to enable mocking the Amazon Managed Grafana service client for testing your code.
Package managedgrafanaiface provides an interface to enable mocking the Amazon Managed Grafana service client for testing your code.
Package marketplacecatalog provides the client and types for making API requests to AWS Marketplace Catalog Service.
Package marketplacecatalog provides the client and types for making API requests to AWS Marketplace Catalog Service.
Package marketplacecatalogiface provides an interface to enable mocking the AWS Marketplace Catalog Service service client for testing your code.
Package marketplacecatalogiface provides an interface to enable mocking the AWS Marketplace Catalog Service service client for testing your code.
Package marketplacecommerceanalytics provides the client and types for making API requests to AWS Marketplace Commerce Analytics.
Package marketplacecommerceanalytics provides the client and types for making API requests to AWS Marketplace Commerce Analytics.
Package marketplacecommerceanalyticsiface provides an interface to enable mocking the AWS Marketplace Commerce Analytics service client for testing your code.
Package marketplacecommerceanalyticsiface provides an interface to enable mocking the AWS Marketplace Commerce Analytics service client for testing your code.
Package marketplaceentitlementservice provides the client and types for making API requests to AWS Marketplace Entitlement Service.
Package marketplaceentitlementservice provides the client and types for making API requests to AWS Marketplace Entitlement Service.
Package marketplaceentitlementserviceiface provides an interface to enable mocking the AWS Marketplace Entitlement Service service client for testing your code.
Package marketplaceentitlementserviceiface provides an interface to enable mocking the AWS Marketplace Entitlement Service service client for testing your code.
Package marketplacemetering provides the client and types for making API requests to AWSMarketplace Metering.
Package marketplacemetering provides the client and types for making API requests to AWSMarketplace Metering.
Package marketplacemeteringiface provides an interface to enable mocking the AWSMarketplace Metering service client for testing your code.
Package marketplacemeteringiface provides an interface to enable mocking the AWSMarketplace Metering service client for testing your code.
Package mediaconnect provides the client and types for making API requests to AWS MediaConnect.
Package mediaconnect provides the client and types for making API requests to AWS MediaConnect.
Package mediaconnectiface provides an interface to enable mocking the AWS MediaConnect service client for testing your code.
Package mediaconnectiface provides an interface to enable mocking the AWS MediaConnect service client for testing your code.
Package mediaconvert provides the client and types for making API requests to AWS Elemental MediaConvert.
Package mediaconvert provides the client and types for making API requests to AWS Elemental MediaConvert.
Package mediaconvertiface provides an interface to enable mocking the AWS Elemental MediaConvert service client for testing your code.
Package mediaconvertiface provides an interface to enable mocking the AWS Elemental MediaConvert service client for testing your code.
Package medialive provides the client and types for making API requests to AWS Elemental MediaLive.
Package medialive provides the client and types for making API requests to AWS Elemental MediaLive.
Package medialiveiface provides an interface to enable mocking the AWS Elemental MediaLive service client for testing your code.
Package medialiveiface provides an interface to enable mocking the AWS Elemental MediaLive service client for testing your code.
Package mediapackage provides the client and types for making API requests to AWS Elemental MediaPackage.
Package mediapackage provides the client and types for making API requests to AWS Elemental MediaPackage.
Package mediapackageiface provides an interface to enable mocking the AWS Elemental MediaPackage service client for testing your code.
Package mediapackageiface provides an interface to enable mocking the AWS Elemental MediaPackage service client for testing your code.
Package mediapackagevod provides the client and types for making API requests to AWS Elemental MediaPackage VOD.
Package mediapackagevod provides the client and types for making API requests to AWS Elemental MediaPackage VOD.
Package mediapackagevodiface provides an interface to enable mocking the AWS Elemental MediaPackage VOD service client for testing your code.
Package mediapackagevodiface provides an interface to enable mocking the AWS Elemental MediaPackage VOD service client for testing your code.
Package mediastore provides the client and types for making API requests to AWS Elemental MediaStore.
Package mediastore provides the client and types for making API requests to AWS Elemental MediaStore.
Package mediastoreiface provides an interface to enable mocking the AWS Elemental MediaStore service client for testing your code.
Package mediastoreiface provides an interface to enable mocking the AWS Elemental MediaStore service client for testing your code.
Package mediastoredata provides the client and types for making API requests to AWS Elemental MediaStore Data Plane.
Package mediastoredata provides the client and types for making API requests to AWS Elemental MediaStore Data Plane.
Package mediastoredataiface provides an interface to enable mocking the AWS Elemental MediaStore Data Plane service client for testing your code.
Package mediastoredataiface provides an interface to enable mocking the AWS Elemental MediaStore Data Plane service client for testing your code.
Package mediatailor provides the client and types for making API requests to AWS MediaTailor.
Package mediatailor provides the client and types for making API requests to AWS MediaTailor.
Package mediatailoriface provides an interface to enable mocking the AWS MediaTailor service client for testing your code.
Package mediatailoriface provides an interface to enable mocking the AWS MediaTailor service client for testing your code.
Package memorydb provides the client and types for making API requests to Amazon MemoryDB.
Package memorydb provides the client and types for making API requests to Amazon MemoryDB.
Package memorydbiface provides an interface to enable mocking the Amazon MemoryDB service client for testing your code.
Package memorydbiface provides an interface to enable mocking the Amazon MemoryDB service client for testing your code.
Package mgn provides the client and types for making API requests to Application Migration Service.
Package mgn provides the client and types for making API requests to Application Migration Service.
Package mgniface provides an interface to enable mocking the Application Migration Service service client for testing your code.
Package mgniface provides an interface to enable mocking the Application Migration Service service client for testing your code.
Package migrationhub provides the client and types for making API requests to AWS Migration Hub.
Package migrationhub provides the client and types for making API requests to AWS Migration Hub.
Package migrationhubiface provides an interface to enable mocking the AWS Migration Hub service client for testing your code.
Package migrationhubiface provides an interface to enable mocking the AWS Migration Hub service client for testing your code.
Package migrationhubconfig provides the client and types for making API requests to AWS Migration Hub Config.
Package migrationhubconfig provides the client and types for making API requests to AWS Migration Hub Config.
Package migrationhubconfigiface provides an interface to enable mocking the AWS Migration Hub Config service client for testing your code.
Package migrationhubconfigiface provides an interface to enable mocking the AWS Migration Hub Config service client for testing your code.
Package migrationhubrefactorspaces provides the client and types for making API requests to AWS Migration Hub Refactor Spaces.
Package migrationhubrefactorspaces provides the client and types for making API requests to AWS Migration Hub Refactor Spaces.
Package migrationhubrefactorspacesiface provides an interface to enable mocking the AWS Migration Hub Refactor Spaces service client for testing your code.
Package migrationhubrefactorspacesiface provides an interface to enable mocking the AWS Migration Hub Refactor Spaces service client for testing your code.
Package migrationhubstrategyrecommendations provides the client and types for making API requests to Migration Hub Strategy Recommendations.
Package migrationhubstrategyrecommendations provides the client and types for making API requests to Migration Hub Strategy Recommendations.
Package migrationhubstrategyrecommendationsiface provides an interface to enable mocking the Migration Hub Strategy Recommendations service client for testing your code.
Package migrationhubstrategyrecommendationsiface provides an interface to enable mocking the Migration Hub Strategy Recommendations service client for testing your code.
Package mobile provides the client and types for making API requests to AWS Mobile.
Package mobile provides the client and types for making API requests to AWS Mobile.
Package mobileiface provides an interface to enable mocking the AWS Mobile service client for testing your code.
Package mobileiface provides an interface to enable mocking the AWS Mobile service client for testing your code.
Package mobileanalytics provides the client and types for making API requests to Amazon Mobile Analytics.
Package mobileanalytics provides the client and types for making API requests to Amazon Mobile Analytics.
Package mobileanalyticsiface provides an interface to enable mocking the Amazon Mobile Analytics service client for testing your code.
Package mobileanalyticsiface provides an interface to enable mocking the Amazon Mobile Analytics service client for testing your code.
Package mq provides the client and types for making API requests to AmazonMQ.
Package mq provides the client and types for making API requests to AmazonMQ.
Package mqiface provides an interface to enable mocking the AmazonMQ service client for testing your code.
Package mqiface provides an interface to enable mocking the AmazonMQ service client for testing your code.
Package mturk provides the client and types for making API requests to Amazon Mechanical Turk.
Package mturk provides the client and types for making API requests to Amazon Mechanical Turk.
Package mturkiface provides an interface to enable mocking the Amazon Mechanical Turk service client for testing your code.
Package mturkiface provides an interface to enable mocking the Amazon Mechanical Turk service client for testing your code.
Package mwaa provides the client and types for making API requests to AmazonMWAA.
Package mwaa provides the client and types for making API requests to AmazonMWAA.
Package mwaaiface provides an interface to enable mocking the AmazonMWAA service client for testing your code.
Package mwaaiface provides an interface to enable mocking the AmazonMWAA service client for testing your code.
Package neptune provides the client and types for making API requests to Amazon Neptune.
Package neptune provides the client and types for making API requests to Amazon Neptune.
Package neptuneiface provides an interface to enable mocking the Amazon Neptune service client for testing your code.
Package neptuneiface provides an interface to enable mocking the Amazon Neptune service client for testing your code.
Package networkfirewall provides the client and types for making API requests to AWS Network Firewall.
Package networkfirewall provides the client and types for making API requests to AWS Network Firewall.
Package networkfirewalliface provides an interface to enable mocking the AWS Network Firewall service client for testing your code.
Package networkfirewalliface provides an interface to enable mocking the AWS Network Firewall service client for testing your code.
Package networkmanager provides the client and types for making API requests to AWS Network Manager.
Package networkmanager provides the client and types for making API requests to AWS Network Manager.
Package networkmanageriface provides an interface to enable mocking the AWS Network Manager service client for testing your code.
Package networkmanageriface provides an interface to enable mocking the AWS Network Manager service client for testing your code.
Package nimblestudio provides the client and types for making API requests to AmazonNimbleStudio.
Package nimblestudio provides the client and types for making API requests to AmazonNimbleStudio.
Package nimblestudioiface provides an interface to enable mocking the AmazonNimbleStudio service client for testing your code.
Package nimblestudioiface provides an interface to enable mocking the AmazonNimbleStudio service client for testing your code.
Package opensearchservice provides the client and types for making API requests to Amazon OpenSearch Service.
Package opensearchservice provides the client and types for making API requests to Amazon OpenSearch Service.
Package opensearchserviceiface provides an interface to enable mocking the Amazon OpenSearch Service service client for testing your code.
Package opensearchserviceiface provides an interface to enable mocking the Amazon OpenSearch Service service client for testing your code.
Package opsworks provides the client and types for making API requests to AWS OpsWorks.
Package opsworks provides the client and types for making API requests to AWS OpsWorks.
Package opsworksiface provides an interface to enable mocking the AWS OpsWorks service client for testing your code.
Package opsworksiface provides an interface to enable mocking the AWS OpsWorks service client for testing your code.
Package opsworkscm provides the client and types for making API requests to AWS OpsWorks CM.
Package opsworkscm provides the client and types for making API requests to AWS OpsWorks CM.
Package opsworkscmiface provides an interface to enable mocking the AWS OpsWorks CM service client for testing your code.
Package opsworkscmiface provides an interface to enable mocking the AWS OpsWorks CM service client for testing your code.
Package organizations provides the client and types for making API requests to AWS Organizations.
Package organizations provides the client and types for making API requests to AWS Organizations.
Package organizationsiface provides an interface to enable mocking the AWS Organizations service client for testing your code.
Package organizationsiface provides an interface to enable mocking the AWS Organizations service client for testing your code.
Package outposts provides the client and types for making API requests to AWS Outposts.
Package outposts provides the client and types for making API requests to AWS Outposts.
Package outpostsiface provides an interface to enable mocking the AWS Outposts service client for testing your code.
Package outpostsiface provides an interface to enable mocking the AWS Outposts service client for testing your code.
Package panorama provides the client and types for making API requests to AWS Panorama.
Package panorama provides the client and types for making API requests to AWS Panorama.
Package panoramaiface provides an interface to enable mocking the AWS Panorama service client for testing your code.
Package panoramaiface provides an interface to enable mocking the AWS Panorama service client for testing your code.
Package personalize provides the client and types for making API requests to Amazon Personalize.
Package personalize provides the client and types for making API requests to Amazon Personalize.
Package personalizeiface provides an interface to enable mocking the Amazon Personalize service client for testing your code.
Package personalizeiface provides an interface to enable mocking the Amazon Personalize service client for testing your code.
Package personalizeevents provides the client and types for making API requests to Amazon Personalize Events.
Package personalizeevents provides the client and types for making API requests to Amazon Personalize Events.
Package personalizeeventsiface provides an interface to enable mocking the Amazon Personalize Events service client for testing your code.
Package personalizeeventsiface provides an interface to enable mocking the Amazon Personalize Events service client for testing your code.
Package personalizeruntime provides the client and types for making API requests to Amazon Personalize Runtime.
Package personalizeruntime provides the client and types for making API requests to Amazon Personalize Runtime.
Package personalizeruntimeiface provides an interface to enable mocking the Amazon Personalize Runtime service client for testing your code.
Package personalizeruntimeiface provides an interface to enable mocking the Amazon Personalize Runtime service client for testing your code.
Package pi provides the client and types for making API requests to AWS Performance Insights.
Package pi provides the client and types for making API requests to AWS Performance Insights.
Package piiface provides an interface to enable mocking the AWS Performance Insights service client for testing your code.
Package piiface provides an interface to enable mocking the AWS Performance Insights service client for testing your code.
Package pinpoint provides the client and types for making API requests to Amazon Pinpoint.
Package pinpoint provides the client and types for making API requests to Amazon Pinpoint.
Package pinpointiface provides an interface to enable mocking the Amazon Pinpoint service client for testing your code.
Package pinpointiface provides an interface to enable mocking the Amazon Pinpoint service client for testing your code.
Package pinpointemail provides the client and types for making API requests to Amazon Pinpoint Email Service.
Package pinpointemail provides the client and types for making API requests to Amazon Pinpoint Email Service.
Package pinpointemailiface provides an interface to enable mocking the Amazon Pinpoint Email Service service client for testing your code.
Package pinpointemailiface provides an interface to enable mocking the Amazon Pinpoint Email Service service client for testing your code.
Package pinpointsmsvoice provides the client and types for making API requests to Amazon Pinpoint SMS and Voice Service.
Package pinpointsmsvoice provides the client and types for making API requests to Amazon Pinpoint SMS and Voice Service.
Package pinpointsmsvoiceiface provides an interface to enable mocking the Amazon Pinpoint SMS and Voice Service service client for testing your code.
Package pinpointsmsvoiceiface provides an interface to enable mocking the Amazon Pinpoint SMS and Voice Service service client for testing your code.
Package pinpointsmsvoicev2 provides the client and types for making API requests to Amazon Pinpoint SMS Voice V2.
Package pinpointsmsvoicev2 provides the client and types for making API requests to Amazon Pinpoint SMS Voice V2.
Package pinpointsmsvoicev2iface provides an interface to enable mocking the Amazon Pinpoint SMS Voice V2 service client for testing your code.
Package pinpointsmsvoicev2iface provides an interface to enable mocking the Amazon Pinpoint SMS Voice V2 service client for testing your code.
Package polly provides the client and types for making API requests to Amazon Polly.
Package polly provides the client and types for making API requests to Amazon Polly.
Package pollyiface provides an interface to enable mocking the Amazon Polly service client for testing your code.
Package pollyiface provides an interface to enable mocking the Amazon Polly service client for testing your code.
Package pricing provides the client and types for making API requests to AWS Price List Service.
Package pricing provides the client and types for making API requests to AWS Price List Service.
Package pricingiface provides an interface to enable mocking the AWS Price List Service service client for testing your code.
Package pricingiface provides an interface to enable mocking the AWS Price List Service service client for testing your code.
Package prometheusservice provides the client and types for making API requests to Amazon Prometheus Service.
Package prometheusservice provides the client and types for making API requests to Amazon Prometheus Service.
Package prometheusserviceiface provides an interface to enable mocking the Amazon Prometheus Service service client for testing your code.
Package prometheusserviceiface provides an interface to enable mocking the Amazon Prometheus Service service client for testing your code.
Package proton provides the client and types for making API requests to AWS Proton.
Package proton provides the client and types for making API requests to AWS Proton.
Package protoniface provides an interface to enable mocking the AWS Proton service client for testing your code.
Package protoniface provides an interface to enable mocking the AWS Proton service client for testing your code.
Package qldb provides the client and types for making API requests to Amazon QLDB.
Package qldb provides the client and types for making API requests to Amazon QLDB.
Package qldbiface provides an interface to enable mocking the Amazon QLDB service client for testing your code.
Package qldbiface provides an interface to enable mocking the Amazon QLDB service client for testing your code.
Package qldbsession provides the client and types for making API requests to Amazon QLDB Session.
Package qldbsession provides the client and types for making API requests to Amazon QLDB Session.
Package qldbsessioniface provides an interface to enable mocking the Amazon QLDB Session service client for testing your code.
Package qldbsessioniface provides an interface to enable mocking the Amazon QLDB Session service client for testing your code.
Package quicksight provides the client and types for making API requests to Amazon QuickSight.
Package quicksight provides the client and types for making API requests to Amazon QuickSight.
Package quicksightiface provides an interface to enable mocking the Amazon QuickSight service client for testing your code.
Package quicksightiface provides an interface to enable mocking the Amazon QuickSight service client for testing your code.
Package ram provides the client and types for making API requests to AWS Resource Access Manager.
Package ram provides the client and types for making API requests to AWS Resource Access Manager.
Package ramiface provides an interface to enable mocking the AWS Resource Access Manager service client for testing your code.
Package ramiface provides an interface to enable mocking the AWS Resource Access Manager service client for testing your code.
Package rds provides the client and types for making API requests to Amazon Relational Database Service.
Package rds provides the client and types for making API requests to Amazon Relational Database Service.
Package rdsiface provides an interface to enable mocking the Amazon Relational Database Service service client for testing your code.
Package rdsiface provides an interface to enable mocking the Amazon Relational Database Service service client for testing your code.
Package rdsutils is used to generate authentication tokens used to connect to a givent Amazon Relational Database Service (RDS) database.
Package rdsutils is used to generate authentication tokens used to connect to a givent Amazon Relational Database Service (RDS) database.
Package rdsdataservice provides the client and types for making API requests to AWS RDS DataService.
Package rdsdataservice provides the client and types for making API requests to AWS RDS DataService.
Package rdsdataserviceiface provides an interface to enable mocking the AWS RDS DataService service client for testing your code.
Package rdsdataserviceiface provides an interface to enable mocking the AWS RDS DataService service client for testing your code.
Package recyclebin provides the client and types for making API requests to Amazon Recycle Bin.
Package recyclebin provides the client and types for making API requests to Amazon Recycle Bin.
Package recyclebiniface provides an interface to enable mocking the Amazon Recycle Bin service client for testing your code.
Package recyclebiniface provides an interface to enable mocking the Amazon Recycle Bin service client for testing your code.
Package redshift provides the client and types for making API requests to Amazon Redshift.
Package redshift provides the client and types for making API requests to Amazon Redshift.
Package redshiftiface provides an interface to enable mocking the Amazon Redshift service client for testing your code.
Package redshiftiface provides an interface to enable mocking the Amazon Redshift service client for testing your code.
Package redshiftdataapiservice provides the client and types for making API requests to Redshift Data API Service.
Package redshiftdataapiservice provides the client and types for making API requests to Redshift Data API Service.
Package redshiftdataapiserviceiface provides an interface to enable mocking the Redshift Data API Service service client for testing your code.
Package redshiftdataapiserviceiface provides an interface to enable mocking the Redshift Data API Service service client for testing your code.
Package rekognition provides the client and types for making API requests to Amazon Rekognition.
Package rekognition provides the client and types for making API requests to Amazon Rekognition.
Package rekognitioniface provides an interface to enable mocking the Amazon Rekognition service client for testing your code.
Package rekognitioniface provides an interface to enable mocking the Amazon Rekognition service client for testing your code.
Package resiliencehub provides the client and types for making API requests to AWS Resilience Hub.
Package resiliencehub provides the client and types for making API requests to AWS Resilience Hub.
Package resiliencehubiface provides an interface to enable mocking the AWS Resilience Hub service client for testing your code.
Package resiliencehubiface provides an interface to enable mocking the AWS Resilience Hub service client for testing your code.
Package resourcegroups provides the client and types for making API requests to AWS Resource Groups.
Package resourcegroups provides the client and types for making API requests to AWS Resource Groups.
Package resourcegroupsiface provides an interface to enable mocking the AWS Resource Groups service client for testing your code.
Package resourcegroupsiface provides an interface to enable mocking the AWS Resource Groups service client for testing your code.
Package resourcegroupstaggingapi provides the client and types for making API requests to AWS Resource Groups Tagging API.
Package resourcegroupstaggingapi provides the client and types for making API requests to AWS Resource Groups Tagging API.
Package resourcegroupstaggingapiiface provides an interface to enable mocking the AWS Resource Groups Tagging API service client for testing your code.
Package resourcegroupstaggingapiiface provides an interface to enable mocking the AWS Resource Groups Tagging API service client for testing your code.
Package robomaker provides the client and types for making API requests to AWS RoboMaker.
Package robomaker provides the client and types for making API requests to AWS RoboMaker.
Package robomakeriface provides an interface to enable mocking the AWS RoboMaker service client for testing your code.
Package robomakeriface provides an interface to enable mocking the AWS RoboMaker service client for testing your code.
Package route53 provides the client and types for making API requests to Amazon Route 53.
Package route53 provides the client and types for making API requests to Amazon Route 53.
Package route53iface provides an interface to enable mocking the Amazon Route 53 service client for testing your code.
Package route53iface provides an interface to enable mocking the Amazon Route 53 service client for testing your code.
Package route53domains provides the client and types for making API requests to Amazon Route 53 Domains.
Package route53domains provides the client and types for making API requests to Amazon Route 53 Domains.
Package route53domainsiface provides an interface to enable mocking the Amazon Route 53 Domains service client for testing your code.
Package route53domainsiface provides an interface to enable mocking the Amazon Route 53 Domains service client for testing your code.
Package route53recoverycluster provides the client and types for making API requests to Route53 Recovery Cluster.
Package route53recoverycluster provides the client and types for making API requests to Route53 Recovery Cluster.
Package route53recoveryclusteriface provides an interface to enable mocking the Route53 Recovery Cluster service client for testing your code.
Package route53recoveryclusteriface provides an interface to enable mocking the Route53 Recovery Cluster service client for testing your code.
Package route53recoverycontrolconfig provides the client and types for making API requests to AWS Route53 Recovery Control Config.
Package route53recoverycontrolconfig provides the client and types for making API requests to AWS Route53 Recovery Control Config.
Package route53recoverycontrolconfigiface provides an interface to enable mocking the AWS Route53 Recovery Control Config service client for testing your code.
Package route53recoverycontrolconfigiface provides an interface to enable mocking the AWS Route53 Recovery Control Config service client for testing your code.
Package route53recoveryreadiness provides the client and types for making API requests to AWS Route53 Recovery Readiness.
Package route53recoveryreadiness provides the client and types for making API requests to AWS Route53 Recovery Readiness.
Package route53recoveryreadinessiface provides an interface to enable mocking the AWS Route53 Recovery Readiness service client for testing your code.
Package route53recoveryreadinessiface provides an interface to enable mocking the AWS Route53 Recovery Readiness service client for testing your code.
Package route53resolver provides the client and types for making API requests to Amazon Route 53 Resolver.
Package route53resolver provides the client and types for making API requests to Amazon Route 53 Resolver.
Package route53resolveriface provides an interface to enable mocking the Amazon Route 53 Resolver service client for testing your code.
Package route53resolveriface provides an interface to enable mocking the Amazon Route 53 Resolver service client for testing your code.
Package s3 provides the client and types for making API requests to Amazon Simple Storage Service.
Package s3 provides the client and types for making API requests to Amazon Simple Storage Service.
Package s3crypto provides encryption to S3 using KMS and AES GCM.
Package s3crypto provides encryption to S3 using KMS and AES GCM.
Package s3iface provides an interface to enable mocking the Amazon Simple Storage Service service client for testing your code.
Package s3iface provides an interface to enable mocking the Amazon Simple Storage Service service client for testing your code.
Package s3manager provides utilities to upload and download objects from S3 concurrently.
Package s3manager provides utilities to upload and download objects from S3 concurrently.
Package s3manageriface provides an interface for the s3manager package
Package s3manageriface provides an interface for the s3manager package
Package s3control provides the client and types for making API requests to AWS S3 Control.
Package s3control provides the client and types for making API requests to AWS S3 Control.
Package s3controliface provides an interface to enable mocking the AWS S3 Control service client for testing your code.
Package s3controliface provides an interface to enable mocking the AWS S3 Control service client for testing your code.
Package s3outposts provides the client and types for making API requests to Amazon S3 on Outposts.
Package s3outposts provides the client and types for making API requests to Amazon S3 on Outposts.
Package s3outpostsiface provides an interface to enable mocking the Amazon S3 on Outposts service client for testing your code.
Package s3outpostsiface provides an interface to enable mocking the Amazon S3 on Outposts service client for testing your code.
Package sagemaker provides the client and types for making API requests to Amazon SageMaker Service.
Package sagemaker provides the client and types for making API requests to Amazon SageMaker Service.
Package sagemakeriface provides an interface to enable mocking the Amazon SageMaker Service service client for testing your code.
Package sagemakeriface provides an interface to enable mocking the Amazon SageMaker Service service client for testing your code.
Package sagemakeredgemanager provides the client and types for making API requests to Amazon Sagemaker Edge Manager.
Package sagemakeredgemanager provides the client and types for making API requests to Amazon Sagemaker Edge Manager.
Package sagemakeredgemanageriface provides an interface to enable mocking the Amazon Sagemaker Edge Manager service client for testing your code.
Package sagemakeredgemanageriface provides an interface to enable mocking the Amazon Sagemaker Edge Manager service client for testing your code.
Package sagemakerfeaturestoreruntime provides the client and types for making API requests to Amazon SageMaker Feature Store Runtime.
Package sagemakerfeaturestoreruntime provides the client and types for making API requests to Amazon SageMaker Feature Store Runtime.
Package sagemakerfeaturestoreruntimeiface provides an interface to enable mocking the Amazon SageMaker Feature Store Runtime service client for testing your code.
Package sagemakerfeaturestoreruntimeiface provides an interface to enable mocking the Amazon SageMaker Feature Store Runtime service client for testing your code.
Package sagemakerruntime provides the client and types for making API requests to Amazon SageMaker Runtime.
Package sagemakerruntime provides the client and types for making API requests to Amazon SageMaker Runtime.
Package sagemakerruntimeiface provides an interface to enable mocking the Amazon SageMaker Runtime service client for testing your code.
Package sagemakerruntimeiface provides an interface to enable mocking the Amazon SageMaker Runtime service client for testing your code.
Package savingsplans provides the client and types for making API requests to AWS Savings Plans.
Package savingsplans provides the client and types for making API requests to AWS Savings Plans.
Package savingsplansiface provides an interface to enable mocking the AWS Savings Plans service client for testing your code.
Package savingsplansiface provides an interface to enable mocking the AWS Savings Plans service client for testing your code.
Package schemas provides the client and types for making API requests to Schemas.
Package schemas provides the client and types for making API requests to Schemas.
Package schemasiface provides an interface to enable mocking the Schemas service client for testing your code.
Package schemasiface provides an interface to enable mocking the Schemas service client for testing your code.
Package secretsmanager provides the client and types for making API requests to AWS Secrets Manager.
Package secretsmanager provides the client and types for making API requests to AWS Secrets Manager.
Package secretsmanageriface provides an interface to enable mocking the AWS Secrets Manager service client for testing your code.
Package secretsmanageriface provides an interface to enable mocking the AWS Secrets Manager service client for testing your code.
Package securityhub provides the client and types for making API requests to AWS SecurityHub.
Package securityhub provides the client and types for making API requests to AWS SecurityHub.
Package securityhubiface provides an interface to enable mocking the AWS SecurityHub service client for testing your code.
Package securityhubiface provides an interface to enable mocking the AWS SecurityHub service client for testing your code.
Package serverlessapplicationrepository provides the client and types for making API requests to AWSServerlessApplicationRepository.
Package serverlessapplicationrepository provides the client and types for making API requests to AWSServerlessApplicationRepository.
Package serverlessapplicationrepositoryiface provides an interface to enable mocking the AWSServerlessApplicationRepository service client for testing your code.
Package serverlessapplicationrepositoryiface provides an interface to enable mocking the AWSServerlessApplicationRepository service client for testing your code.
Package servicecatalog provides the client and types for making API requests to AWS Service Catalog.
Package servicecatalog provides the client and types for making API requests to AWS Service Catalog.
Package servicecatalogiface provides an interface to enable mocking the AWS Service Catalog service client for testing your code.
Package servicecatalogiface provides an interface to enable mocking the AWS Service Catalog service client for testing your code.
Package servicediscovery provides the client and types for making API requests to AWS Cloud Map.
Package servicediscovery provides the client and types for making API requests to AWS Cloud Map.
Package servicediscoveryiface provides an interface to enable mocking the AWS Cloud Map service client for testing your code.
Package servicediscoveryiface provides an interface to enable mocking the AWS Cloud Map service client for testing your code.
Package servicequotas provides the client and types for making API requests to Service Quotas.
Package servicequotas provides the client and types for making API requests to Service Quotas.
Package servicequotasiface provides an interface to enable mocking the Service Quotas service client for testing your code.
Package servicequotasiface provides an interface to enable mocking the Service Quotas service client for testing your code.
Package ses provides the client and types for making API requests to Amazon Simple Email Service.
Package ses provides the client and types for making API requests to Amazon Simple Email Service.
Package sesiface provides an interface to enable mocking the Amazon Simple Email Service service client for testing your code.
Package sesiface provides an interface to enable mocking the Amazon Simple Email Service service client for testing your code.
Package sesv2 provides the client and types for making API requests to Amazon Simple Email Service.
Package sesv2 provides the client and types for making API requests to Amazon Simple Email Service.
Package sesv2iface provides an interface to enable mocking the Amazon Simple Email Service service client for testing your code.
Package sesv2iface provides an interface to enable mocking the Amazon Simple Email Service service client for testing your code.
Package sfn provides the client and types for making API requests to AWS Step Functions.
Package sfn provides the client and types for making API requests to AWS Step Functions.
Package sfniface provides an interface to enable mocking the AWS Step Functions service client for testing your code.
Package sfniface provides an interface to enable mocking the AWS Step Functions service client for testing your code.
Package shield provides the client and types for making API requests to AWS Shield.
Package shield provides the client and types for making API requests to AWS Shield.
Package shieldiface provides an interface to enable mocking the AWS Shield service client for testing your code.
Package shieldiface provides an interface to enable mocking the AWS Shield service client for testing your code.
Package signer provides the client and types for making API requests to AWS Signer.
Package signer provides the client and types for making API requests to AWS Signer.
Package signeriface provides an interface to enable mocking the AWS Signer service client for testing your code.
Package signeriface provides an interface to enable mocking the AWS Signer service client for testing your code.
Package simpledb provides the client and types for making API requests to Amazon SimpleDB.
Package simpledb provides the client and types for making API requests to Amazon SimpleDB.
Package simpledbiface provides an interface to enable mocking the Amazon SimpleDB service client for testing your code.
Package simpledbiface provides an interface to enable mocking the Amazon SimpleDB service client for testing your code.
Package sms provides the client and types for making API requests to AWS Server Migration Service.
Package sms provides the client and types for making API requests to AWS Server Migration Service.
Package smsiface provides an interface to enable mocking the AWS Server Migration Service service client for testing your code.
Package smsiface provides an interface to enable mocking the AWS Server Migration Service service client for testing your code.
Package snowball provides the client and types for making API requests to Amazon Import/Export Snowball.
Package snowball provides the client and types for making API requests to Amazon Import/Export Snowball.
Package snowballiface provides an interface to enable mocking the Amazon Import/Export Snowball service client for testing your code.
Package snowballiface provides an interface to enable mocking the Amazon Import/Export Snowball service client for testing your code.
Package snowdevicemanagement provides the client and types for making API requests to AWS Snow Device Management.
Package snowdevicemanagement provides the client and types for making API requests to AWS Snow Device Management.
Package snowdevicemanagementiface provides an interface to enable mocking the AWS Snow Device Management service client for testing your code.
Package snowdevicemanagementiface provides an interface to enable mocking the AWS Snow Device Management service client for testing your code.
Package sns provides the client and types for making API requests to Amazon Simple Notification Service.
Package sns provides the client and types for making API requests to Amazon Simple Notification Service.
Package snsiface provides an interface to enable mocking the Amazon Simple Notification Service service client for testing your code.
Package snsiface provides an interface to enable mocking the Amazon Simple Notification Service service client for testing your code.
Package sqs provides the client and types for making API requests to Amazon Simple Queue Service.
Package sqs provides the client and types for making API requests to Amazon Simple Queue Service.
Package sqsiface provides an interface to enable mocking the Amazon Simple Queue Service service client for testing your code.
Package sqsiface provides an interface to enable mocking the Amazon Simple Queue Service service client for testing your code.
Package ssm provides the client and types for making API requests to Amazon Simple Systems Manager (SSM).
Package ssm provides the client and types for making API requests to Amazon Simple Systems Manager (SSM).
Package ssmiface provides an interface to enable mocking the Amazon Simple Systems Manager (SSM) service client for testing your code.
Package ssmiface provides an interface to enable mocking the Amazon Simple Systems Manager (SSM) service client for testing your code.
Package ssmcontacts provides the client and types for making API requests to AWS Systems Manager Incident Manager Contacts.
Package ssmcontacts provides the client and types for making API requests to AWS Systems Manager Incident Manager Contacts.
Package ssmcontactsiface provides an interface to enable mocking the AWS Systems Manager Incident Manager Contacts service client for testing your code.
Package ssmcontactsiface provides an interface to enable mocking the AWS Systems Manager Incident Manager Contacts service client for testing your code.
Package ssmincidents provides the client and types for making API requests to AWS Systems Manager Incident Manager.
Package ssmincidents provides the client and types for making API requests to AWS Systems Manager Incident Manager.
Package ssmincidentsiface provides an interface to enable mocking the AWS Systems Manager Incident Manager service client for testing your code.
Package ssmincidentsiface provides an interface to enable mocking the AWS Systems Manager Incident Manager service client for testing your code.
Package sso provides the client and types for making API requests to AWS Single Sign-On.
Package sso provides the client and types for making API requests to AWS Single Sign-On.
Package ssoiface provides an interface to enable mocking the AWS Single Sign-On service client for testing your code.
Package ssoiface provides an interface to enable mocking the AWS Single Sign-On service client for testing your code.
Package ssoadmin provides the client and types for making API requests to AWS Single Sign-On Admin.
Package ssoadmin provides the client and types for making API requests to AWS Single Sign-On Admin.
Package ssoadminiface provides an interface to enable mocking the AWS Single Sign-On Admin service client for testing your code.
Package ssoadminiface provides an interface to enable mocking the AWS Single Sign-On Admin service client for testing your code.
Package ssooidc provides the client and types for making API requests to AWS SSO OIDC.
Package ssooidc provides the client and types for making API requests to AWS SSO OIDC.
Package ssooidciface provides an interface to enable mocking the AWS SSO OIDC service client for testing your code.
Package ssooidciface provides an interface to enable mocking the AWS SSO OIDC service client for testing your code.
Package storagegateway provides the client and types for making API requests to AWS Storage Gateway.
Package storagegateway provides the client and types for making API requests to AWS Storage Gateway.
Package storagegatewayiface provides an interface to enable mocking the AWS Storage Gateway service client for testing your code.
Package storagegatewayiface provides an interface to enable mocking the AWS Storage Gateway service client for testing your code.
Package sts provides the client and types for making API requests to AWS Security Token Service.
Package sts provides the client and types for making API requests to AWS Security Token Service.
Package stsiface provides an interface to enable mocking the AWS Security Token Service service client for testing your code.
Package stsiface provides an interface to enable mocking the AWS Security Token Service service client for testing your code.
Package support provides the client and types for making API requests to AWS Support.
Package support provides the client and types for making API requests to AWS Support.
Package supportiface provides an interface to enable mocking the AWS Support service client for testing your code.
Package supportiface provides an interface to enable mocking the AWS Support service client for testing your code.
Package swf provides the client and types for making API requests to Amazon Simple Workflow Service.
Package swf provides the client and types for making API requests to Amazon Simple Workflow Service.
Package swfiface provides an interface to enable mocking the Amazon Simple Workflow Service service client for testing your code.
Package swfiface provides an interface to enable mocking the Amazon Simple Workflow Service service client for testing your code.
Package synthetics provides the client and types for making API requests to Synthetics.
Package synthetics provides the client and types for making API requests to Synthetics.
Package syntheticsiface provides an interface to enable mocking the Synthetics service client for testing your code.
Package syntheticsiface provides an interface to enable mocking the Synthetics service client for testing your code.
Package textract provides the client and types for making API requests to Amazon Textract.
Package textract provides the client and types for making API requests to Amazon Textract.
Package textractiface provides an interface to enable mocking the Amazon Textract service client for testing your code.
Package textractiface provides an interface to enable mocking the Amazon Textract service client for testing your code.
Package timestreamquery provides the client and types for making API requests to Amazon Timestream Query.
Package timestreamquery provides the client and types for making API requests to Amazon Timestream Query.
Package timestreamqueryiface provides an interface to enable mocking the Amazon Timestream Query service client for testing your code.
Package timestreamqueryiface provides an interface to enable mocking the Amazon Timestream Query service client for testing your code.
Package timestreamwrite provides the client and types for making API requests to Amazon Timestream Write.
Package timestreamwrite provides the client and types for making API requests to Amazon Timestream Write.
Package timestreamwriteiface provides an interface to enable mocking the Amazon Timestream Write service client for testing your code.
Package timestreamwriteiface provides an interface to enable mocking the Amazon Timestream Write service client for testing your code.
Package transcribeservice provides the client and types for making API requests to Amazon Transcribe Service.
Package transcribeservice provides the client and types for making API requests to Amazon Transcribe Service.
Package transcribeserviceiface provides an interface to enable mocking the Amazon Transcribe Service service client for testing your code.
Package transcribeserviceiface provides an interface to enable mocking the Amazon Transcribe Service service client for testing your code.
Package transcribestreamingservice provides the client and types for making API requests to Amazon Transcribe Streaming Service.
Package transcribestreamingservice provides the client and types for making API requests to Amazon Transcribe Streaming Service.
Package transcribestreamingserviceiface provides an interface to enable mocking the Amazon Transcribe Streaming Service service client for testing your code.
Package transcribestreamingserviceiface provides an interface to enable mocking the Amazon Transcribe Streaming Service service client for testing your code.
Package transfer provides the client and types for making API requests to AWS Transfer Family.
Package transfer provides the client and types for making API requests to AWS Transfer Family.
Package transferiface provides an interface to enable mocking the AWS Transfer Family service client for testing your code.
Package transferiface provides an interface to enable mocking the AWS Transfer Family service client for testing your code.
Package translate provides the client and types for making API requests to Amazon Translate.
Package translate provides the client and types for making API requests to Amazon Translate.
Package translateiface provides an interface to enable mocking the Amazon Translate service client for testing your code.
Package translateiface provides an interface to enable mocking the Amazon Translate service client for testing your code.
Package voiceid provides the client and types for making API requests to Amazon Voice ID.
Package voiceid provides the client and types for making API requests to Amazon Voice ID.
Package voiceidiface provides an interface to enable mocking the Amazon Voice ID service client for testing your code.
Package voiceidiface provides an interface to enable mocking the Amazon Voice ID service client for testing your code.
Package waf provides the client and types for making API requests to AWS WAF.
Package waf provides the client and types for making API requests to AWS WAF.
Package wafiface provides an interface to enable mocking the AWS WAF service client for testing your code.
Package wafiface provides an interface to enable mocking the AWS WAF service client for testing your code.
Package wafregional provides the client and types for making API requests to AWS WAF Regional.
Package wafregional provides the client and types for making API requests to AWS WAF Regional.
Package wafregionaliface provides an interface to enable mocking the AWS WAF Regional service client for testing your code.
Package wafregionaliface provides an interface to enable mocking the AWS WAF Regional service client for testing your code.
Package wafv2 provides the client and types for making API requests to AWS WAFV2.
Package wafv2 provides the client and types for making API requests to AWS WAFV2.
Package wafv2iface provides an interface to enable mocking the AWS WAFV2 service client for testing your code.
Package wafv2iface provides an interface to enable mocking the AWS WAFV2 service client for testing your code.
Package wellarchitected provides the client and types for making API requests to AWS Well-Architected Tool.
Package wellarchitected provides the client and types for making API requests to AWS Well-Architected Tool.
Package wellarchitectediface provides an interface to enable mocking the AWS Well-Architected Tool service client for testing your code.
Package wellarchitectediface provides an interface to enable mocking the AWS Well-Architected Tool service client for testing your code.
Package workdocs provides the client and types for making API requests to Amazon WorkDocs.
Package workdocs provides the client and types for making API requests to Amazon WorkDocs.
Package workdocsiface provides an interface to enable mocking the Amazon WorkDocs service client for testing your code.
Package workdocsiface provides an interface to enable mocking the Amazon WorkDocs service client for testing your code.
Package worklink provides the client and types for making API requests to Amazon WorkLink.
Package worklink provides the client and types for making API requests to Amazon WorkLink.
Package worklinkiface provides an interface to enable mocking the Amazon WorkLink service client for testing your code.
Package worklinkiface provides an interface to enable mocking the Amazon WorkLink service client for testing your code.
Package workmail provides the client and types for making API requests to Amazon WorkMail.
Package workmail provides the client and types for making API requests to Amazon WorkMail.
Package workmailiface provides an interface to enable mocking the Amazon WorkMail service client for testing your code.
Package workmailiface provides an interface to enable mocking the Amazon WorkMail service client for testing your code.
Package workmailmessageflow provides the client and types for making API requests to Amazon WorkMail Message Flow.
Package workmailmessageflow provides the client and types for making API requests to Amazon WorkMail Message Flow.
Package workmailmessageflowiface provides an interface to enable mocking the Amazon WorkMail Message Flow service client for testing your code.
Package workmailmessageflowiface provides an interface to enable mocking the Amazon WorkMail Message Flow service client for testing your code.
Package workspaces provides the client and types for making API requests to Amazon WorkSpaces.
Package workspaces provides the client and types for making API requests to Amazon WorkSpaces.
Package workspacesiface provides an interface to enable mocking the Amazon WorkSpaces service client for testing your code.
Package workspacesiface provides an interface to enable mocking the Amazon WorkSpaces service client for testing your code.
Package workspacesweb provides the client and types for making API requests to Amazon WorkSpaces Web.
Package workspacesweb provides the client and types for making API requests to Amazon WorkSpaces Web.
Package workspaceswebiface provides an interface to enable mocking the Amazon WorkSpaces Web service client for testing your code.
Package workspaceswebiface provides an interface to enable mocking the Amazon WorkSpaces Web service client for testing your code.
Package xray provides the client and types for making API requests to AWS X-Ray.
Package xray provides the client and types for making API requests to AWS X-Ray.
Package xrayiface provides an interface to enable mocking the AWS X-Ray service client for testing your code.
Package xrayiface provides an interface to enable mocking the AWS X-Ray service client for testing your code.

Jump to

Keyboard shortcuts

? : This menu
/ : Search site
f or F : Jump to
y or Y : Canonical URL