Back to godoc.org

Package service

v1.34.4
Latest Go to latest

The highest tagged major version is .

Published: Aug 13, 2020 | License: Apache-2.0 | Module: github.com/aws/aws-sdk-go
Path Synopsis
accessanalyzer Package accessanalyzer provides the client and types for making API requests to Access Analyzer.
accessanalyzer/accessanalyzeriface Package accessanalyzeriface provides an interface to enable mocking the Access Analyzer service client for testing your code.
acm Package acm provides the client and types for making API requests to AWS Certificate Manager.
acm/acmiface Package acmiface provides an interface to enable mocking the AWS Certificate Manager service client for testing your code.
acmpca Package acmpca provides the client and types for making API requests to AWS Certificate Manager Private Certificate Authority.
acmpca/acmpcaiface Package acmpcaiface provides an interface to enable mocking the AWS Certificate Manager Private Certificate Authority service client for testing your code.
alexaforbusiness Package alexaforbusiness provides the client and types for making API requests to Alexa For Business.
alexaforbusiness/alexaforbusinessiface Package alexaforbusinessiface provides an interface to enable mocking the Alexa For Business service client for testing your code.
amplify Package amplify provides the client and types for making API requests to AWS Amplify.
amplify/amplifyiface Package amplifyiface provides an interface to enable mocking the AWS Amplify service client for testing your code.
apigateway Package apigateway provides the client and types for making API requests to Amazon API Gateway.
apigateway/apigatewayiface Package apigatewayiface provides an interface to enable mocking the Amazon API Gateway service client for testing your code.
apigatewaymanagementapi Package apigatewaymanagementapi provides the client and types for making API requests to AmazonApiGatewayManagementApi.
apigatewaymanagementapi/apigatewaymanagementapiiface Package apigatewaymanagementapiiface provides an interface to enable mocking the AmazonApiGatewayManagementApi service client for testing your code.
apigatewayv2 Package apigatewayv2 provides the client and types for making API requests to AmazonApiGatewayV2.
apigatewayv2/apigatewayv2iface Package apigatewayv2iface provides an interface to enable mocking the AmazonApiGatewayV2 service client for testing your code.
appconfig Package appconfig provides the client and types for making API requests to Amazon AppConfig.
appconfig/appconfigiface Package appconfigiface provides an interface to enable mocking the Amazon AppConfig service client for testing your code.
applicationautoscaling Package applicationautoscaling provides the client and types for making API requests to Application Auto Scaling.
applicationautoscaling/applicationautoscalingiface Package applicationautoscalingiface provides an interface to enable mocking the Application Auto Scaling service client for testing your code.
applicationdiscoveryservice Package applicationdiscoveryservice provides the client and types for making API requests to AWS Application Discovery Service.
applicationdiscoveryservice/applicationdiscoveryserviceiface Package applicationdiscoveryserviceiface provides an interface to enable mocking the AWS Application Discovery Service service client for testing your code.
applicationinsights Package applicationinsights provides the client and types for making API requests to Amazon CloudWatch Application Insights.
applicationinsights/applicationinsightsiface Package applicationinsightsiface provides an interface to enable mocking the Amazon CloudWatch Application Insights service client for testing your code.
appmesh Package appmesh provides the client and types for making API requests to AWS App Mesh.
appmesh/appmeshiface Package appmeshiface provides an interface to enable mocking the AWS App Mesh service client for testing your code.
appstream Package appstream provides the client and types for making API requests to Amazon AppStream.
appstream/appstreamiface Package appstreamiface provides an interface to enable mocking the Amazon AppStream service client for testing your code.
appsync Package appsync provides the client and types for making API requests to AWS AppSync.
appsync/appsynciface Package appsynciface provides an interface to enable mocking the AWS AppSync service client for testing your code.
athena Package athena provides the client and types for making API requests to Amazon Athena.
athena/athenaiface Package athenaiface provides an interface to enable mocking the Amazon Athena service client for testing your code.
augmentedairuntime Package augmentedairuntime provides the client and types for making API requests to Amazon Augmented AI Runtime.
augmentedairuntime/augmentedairuntimeiface Package augmentedairuntimeiface provides an interface to enable mocking the Amazon Augmented AI Runtime service client for testing your code.
autoscaling Package autoscaling provides the client and types for making API requests to Auto Scaling.
autoscaling/autoscalingiface Package autoscalingiface provides an interface to enable mocking the Auto Scaling service client for testing your code.
autoscalingplans Package autoscalingplans provides the client and types for making API requests to AWS Auto Scaling Plans.
autoscalingplans/autoscalingplansiface Package autoscalingplansiface provides an interface to enable mocking the AWS Auto Scaling Plans service client for testing your code.
backup Package backup provides the client and types for making API requests to AWS Backup.
backup/backupiface Package backupiface provides an interface to enable mocking the AWS Backup service client for testing your code.
batch Package batch provides the client and types for making API requests to AWS Batch.
batch/batchiface Package batchiface provides an interface to enable mocking the AWS Batch service client for testing your code.
braket Package braket provides the client and types for making API requests to Braket.
braket/braketiface Package braketiface provides an interface to enable mocking the Braket service client for testing your code.
budgets Package budgets provides the client and types for making API requests to AWS Budgets.
budgets/budgetsiface Package budgetsiface provides an interface to enable mocking the AWS Budgets service client for testing your code.
chime Package chime provides the client and types for making API requests to Amazon Chime.
chime/chimeiface Package chimeiface provides an interface to enable mocking the Amazon Chime service client for testing your code.
cloud9 Package cloud9 provides the client and types for making API requests to AWS Cloud9.
cloud9/cloud9iface Package cloud9iface provides an interface to enable mocking the AWS Cloud9 service client for testing your code.
clouddirectory Package clouddirectory provides the client and types for making API requests to Amazon CloudDirectory.
clouddirectory/clouddirectoryiface Package clouddirectoryiface provides an interface to enable mocking the Amazon CloudDirectory service client for testing your code.
cloudformation Package cloudformation provides the client and types for making API requests to AWS CloudFormation.
cloudformation/cloudformationiface Package cloudformationiface provides an interface to enable mocking the AWS CloudFormation service client for testing your code.
cloudfront Package cloudfront provides the client and types for making API requests to Amazon CloudFront.
cloudfront/cloudfrontiface Package cloudfrontiface provides an interface to enable mocking the Amazon CloudFront service client for testing your code.
cloudfront/sign Package sign provides utilities to generate signed URLs for Amazon CloudFront.
cloudhsm Package cloudhsm provides the client and types for making API requests to Amazon CloudHSM.
cloudhsm/cloudhsmiface Package cloudhsmiface provides an interface to enable mocking the Amazon CloudHSM service client for testing your code.
cloudhsmv2 Package cloudhsmv2 provides the client and types for making API requests to AWS CloudHSM V2.
cloudhsmv2/cloudhsmv2iface Package cloudhsmv2iface provides an interface to enable mocking the AWS CloudHSM V2 service client for testing your code.
cloudsearch Package cloudsearch provides the client and types for making API requests to Amazon CloudSearch.
cloudsearch/cloudsearchiface Package cloudsearchiface provides an interface to enable mocking the Amazon CloudSearch service client for testing your code.
cloudsearchdomain Package cloudsearchdomain provides the client and types for making API requests to Amazon CloudSearch Domain.
cloudsearchdomain/cloudsearchdomainiface Package cloudsearchdomainiface provides an interface to enable mocking the Amazon CloudSearch Domain service client for testing your code.
cloudtrail Package cloudtrail provides the client and types for making API requests to AWS CloudTrail.
cloudtrail/cloudtrailiface Package cloudtrailiface provides an interface to enable mocking the AWS CloudTrail service client for testing your code.
cloudwatch Package cloudwatch provides the client and types for making API requests to Amazon CloudWatch.
cloudwatch/cloudwatchiface Package cloudwatchiface provides an interface to enable mocking the Amazon CloudWatch service client for testing your code.
cloudwatchevents Package cloudwatchevents provides the client and types for making API requests to Amazon CloudWatch Events.
cloudwatchevents/cloudwatcheventsiface Package cloudwatcheventsiface provides an interface to enable mocking the Amazon CloudWatch Events service client for testing your code.
cloudwatchlogs Package cloudwatchlogs provides the client and types for making API requests to Amazon CloudWatch Logs.
cloudwatchlogs/cloudwatchlogsiface Package cloudwatchlogsiface provides an interface to enable mocking the Amazon CloudWatch Logs service client for testing your code.
codeartifact Package codeartifact provides the client and types for making API requests to CodeArtifact.
codeartifact/codeartifactiface Package codeartifactiface provides an interface to enable mocking the CodeArtifact service client for testing your code.
codebuild Package codebuild provides the client and types for making API requests to AWS CodeBuild.
codebuild/codebuildiface Package codebuildiface provides an interface to enable mocking the AWS CodeBuild service client for testing your code.
codecommit Package codecommit provides the client and types for making API requests to AWS CodeCommit.
codecommit/codecommitiface Package codecommitiface provides an interface to enable mocking the AWS CodeCommit service client for testing your code.
codedeploy Package codedeploy provides the client and types for making API requests to AWS CodeDeploy.
codedeploy/codedeployiface Package codedeployiface provides an interface to enable mocking the AWS CodeDeploy service client for testing your code.
codeguruprofiler Package codeguruprofiler provides the client and types for making API requests to Amazon CodeGuru Profiler.
codeguruprofiler/codeguruprofileriface Package codeguruprofileriface provides an interface to enable mocking the Amazon CodeGuru Profiler service client for testing your code.
codegurureviewer Package codegurureviewer provides the client and types for making API requests to Amazon CodeGuru Reviewer.
codegurureviewer/codegururevieweriface Package codegururevieweriface provides an interface to enable mocking the Amazon CodeGuru Reviewer service client for testing your code.
codepipeline Package codepipeline provides the client and types for making API requests to AWS CodePipeline.
codepipeline/codepipelineiface Package codepipelineiface provides an interface to enable mocking the AWS CodePipeline service client for testing your code.
codestar Package codestar provides the client and types for making API requests to AWS CodeStar.
codestar/codestariface Package codestariface provides an interface to enable mocking the AWS CodeStar service client for testing your code.
codestarconnections Package codestarconnections provides the client and types for making API requests to AWS CodeStar connections.
codestarconnections/codestarconnectionsiface Package codestarconnectionsiface provides an interface to enable mocking the AWS CodeStar connections service client for testing your code.
codestarnotifications Package codestarnotifications provides the client and types for making API requests to AWS CodeStar Notifications.
codestarnotifications/codestarnotificationsiface Package codestarnotificationsiface provides an interface to enable mocking the AWS CodeStar Notifications service client for testing your code.
cognitoidentity Package cognitoidentity provides the client and types for making API requests to Amazon Cognito Identity.
cognitoidentity/cognitoidentityiface Package cognitoidentityiface provides an interface to enable mocking the Amazon Cognito Identity service client for testing your code.
cognitoidentityprovider Package cognitoidentityprovider provides the client and types for making API requests to Amazon Cognito Identity Provider.
cognitoidentityprovider/cognitoidentityprovideriface Package cognitoidentityprovideriface provides an interface to enable mocking the Amazon Cognito Identity Provider service client for testing your code.
cognitosync Package cognitosync provides the client and types for making API requests to Amazon Cognito Sync.
cognitosync/cognitosynciface Package cognitosynciface provides an interface to enable mocking the Amazon Cognito Sync service client for testing your code.
comprehend Package comprehend provides the client and types for making API requests to Amazon Comprehend.
comprehend/comprehendiface Package comprehendiface provides an interface to enable mocking the Amazon Comprehend service client for testing your code.
comprehendmedical Package comprehendmedical provides the client and types for making API requests to AWS Comprehend Medical.
comprehendmedical/comprehendmedicaliface Package comprehendmedicaliface provides an interface to enable mocking the AWS Comprehend Medical service client for testing your code.
computeoptimizer Package computeoptimizer provides the client and types for making API requests to AWS Compute Optimizer.
computeoptimizer/computeoptimizeriface Package computeoptimizeriface provides an interface to enable mocking the AWS Compute Optimizer service client for testing your code.
configservice Package configservice provides the client and types for making API requests to AWS Config.
configservice/configserviceiface Package configserviceiface provides an interface to enable mocking the AWS Config service client for testing your code.
connect Package connect provides the client and types for making API requests to Amazon Connect Service.
connect/connectiface Package connectiface provides an interface to enable mocking the Amazon Connect Service service client for testing your code.
connectparticipant Package connectparticipant provides the client and types for making API requests to Amazon Connect Participant Service.
connectparticipant/connectparticipantiface Package connectparticipantiface provides an interface to enable mocking the Amazon Connect Participant Service service client for testing your code.
costandusagereportservice Package costandusagereportservice provides the client and types for making API requests to AWS Cost and Usage Report Service.
costandusagereportservice/costandusagereportserviceiface Package costandusagereportserviceiface provides an interface to enable mocking the AWS Cost and Usage Report Service service client for testing your code.
costexplorer Package costexplorer provides the client and types for making API requests to AWS Cost Explorer Service.
costexplorer/costexploreriface Package costexploreriface provides an interface to enable mocking the AWS Cost Explorer Service service client for testing your code.
databasemigrationservice Package databasemigrationservice provides the client and types for making API requests to AWS Database Migration Service.
databasemigrationservice/databasemigrationserviceiface Package databasemigrationserviceiface provides an interface to enable mocking the AWS Database Migration Service service client for testing your code.
dataexchange Package dataexchange provides the client and types for making API requests to AWS Data Exchange.
dataexchange/dataexchangeiface Package dataexchangeiface provides an interface to enable mocking the AWS Data Exchange service client for testing your code.
datapipeline Package datapipeline provides the client and types for making API requests to AWS Data Pipeline.
datapipeline/datapipelineiface Package datapipelineiface provides an interface to enable mocking the AWS Data Pipeline service client for testing your code.
datasync Package datasync provides the client and types for making API requests to AWS DataSync.
datasync/datasynciface Package datasynciface provides an interface to enable mocking the AWS DataSync service client for testing your code.
dax Package dax provides the client and types for making API requests to Amazon DynamoDB Accelerator (DAX).
dax/daxiface Package daxiface provides an interface to enable mocking the Amazon DynamoDB Accelerator (DAX) service client for testing your code.
detective Package detective provides the client and types for making API requests to Amazon Detective.
detective/detectiveiface Package detectiveiface provides an interface to enable mocking the Amazon Detective service client for testing your code.
devicefarm Package devicefarm provides the client and types for making API requests to AWS Device Farm.
devicefarm/devicefarmiface Package devicefarmiface provides an interface to enable mocking the AWS Device Farm service client for testing your code.
directconnect Package directconnect provides the client and types for making API requests to AWS Direct Connect.
directconnect/directconnectiface Package directconnectiface provides an interface to enable mocking the AWS Direct Connect service client for testing your code.
directoryservice Package directoryservice provides the client and types for making API requests to AWS Directory Service.
directoryservice/directoryserviceiface Package directoryserviceiface provides an interface to enable mocking the AWS Directory Service service client for testing your code.
dlm Package dlm provides the client and types for making API requests to Amazon Data Lifecycle Manager.
dlm/dlmiface Package dlmiface provides an interface to enable mocking the Amazon Data Lifecycle Manager service client for testing your code.
docdb Package docdb provides the client and types for making API requests to Amazon DocumentDB with MongoDB compatibility.
docdb/docdbiface Package docdbiface provides an interface to enable mocking the Amazon DocumentDB with MongoDB compatibility service client for testing your code.
dynamodb Package dynamodb provides the client and types for making API requests to Amazon DynamoDB.
dynamodb/dynamodbattribute Package dynamodbattribute provides marshaling and unmarshaling utilities to convert between Go types and dynamodb.AttributeValues.
dynamodb/dynamodbiface Package dynamodbiface provides an interface to enable mocking the Amazon DynamoDB service client for testing your code.
dynamodb/expression Package expression provides types and functions to create Amazon DynamoDB Expression strings, ExpressionAttributeNames maps, and ExpressionAttributeValues maps.
dynamodbstreams Package dynamodbstreams provides the client and types for making API requests to Amazon DynamoDB Streams.
dynamodbstreams/dynamodbstreamsiface Package dynamodbstreamsiface provides an interface to enable mocking the Amazon DynamoDB Streams service client for testing your code.
ebs Package ebs provides the client and types for making API requests to Amazon Elastic Block Store.
ebs/ebsiface Package ebsiface provides an interface to enable mocking the Amazon Elastic Block Store service client for testing your code.
ec2 Package ec2 provides the client and types for making API requests to Amazon Elastic Compute Cloud.
ec2/ec2iface Package ec2iface provides an interface to enable mocking the Amazon Elastic Compute Cloud service client for testing your code.
ec2instanceconnect Package ec2instanceconnect provides the client and types for making API requests to AWS EC2 Instance Connect.
ec2instanceconnect/ec2instanceconnectiface Package ec2instanceconnectiface provides an interface to enable mocking the AWS EC2 Instance Connect service client for testing your code.
ecr Package ecr provides the client and types for making API requests to Amazon EC2 Container Registry.
ecr/ecriface Package ecriface provides an interface to enable mocking the Amazon EC2 Container Registry service client for testing your code.
ecs Package ecs provides the client and types for making API requests to Amazon EC2 Container Service.
ecs/ecsiface Package ecsiface provides an interface to enable mocking the Amazon EC2 Container Service service client for testing your code.
efs Package efs provides the client and types for making API requests to Amazon Elastic File System.
efs/efsiface Package efsiface provides an interface to enable mocking the Amazon Elastic File System service client for testing your code.
eks Package eks provides the client and types for making API requests to Amazon Elastic Kubernetes Service.
eks/eksiface Package eksiface provides an interface to enable mocking the Amazon Elastic Kubernetes Service service client for testing your code.
elasticache Package elasticache provides the client and types for making API requests to Amazon ElastiCache.
elasticache/elasticacheiface Package elasticacheiface provides an interface to enable mocking the Amazon ElastiCache service client for testing your code.
elasticbeanstalk Package elasticbeanstalk provides the client and types for making API requests to AWS Elastic Beanstalk.
elasticbeanstalk/elasticbeanstalkiface Package elasticbeanstalkiface provides an interface to enable mocking the AWS Elastic Beanstalk service client for testing your code.
elasticinference Package elasticinference provides the client and types for making API requests to Amazon Elastic Inference.
elasticinference/elasticinferenceiface Package elasticinferenceiface provides an interface to enable mocking the Amazon Elastic Inference service client for testing your code.
elasticsearchservice Package elasticsearchservice provides the client and types for making API requests to Amazon Elasticsearch Service.
elasticsearchservice/elasticsearchserviceiface Package elasticsearchserviceiface provides an interface to enable mocking the Amazon Elasticsearch Service service client for testing your code.
elastictranscoder Package elastictranscoder provides the client and types for making API requests to Amazon Elastic Transcoder.
elastictranscoder/elastictranscoderiface Package elastictranscoderiface provides an interface to enable mocking the Amazon Elastic Transcoder service client for testing your code.
elb Package elb provides the client and types for making API requests to Elastic Load Balancing.
elb/elbiface Package elbiface provides an interface to enable mocking the Elastic Load Balancing service client for testing your code.
elbv2 Package elbv2 provides the client and types for making API requests to Elastic Load Balancing.
elbv2/elbv2iface Package elbv2iface provides an interface to enable mocking the Elastic Load Balancing service client for testing your code.
emr Package emr provides the client and types for making API requests to Amazon Elastic MapReduce.
emr/emriface Package emriface provides an interface to enable mocking the Amazon Elastic MapReduce service client for testing your code.
eventbridge Package eventbridge provides the client and types for making API requests to Amazon EventBridge.
eventbridge/eventbridgeiface Package eventbridgeiface provides an interface to enable mocking the Amazon EventBridge service client for testing your code.
firehose Package firehose provides the client and types for making API requests to Amazon Kinesis Firehose.
firehose/firehoseiface Package firehoseiface provides an interface to enable mocking the Amazon Kinesis Firehose service client for testing your code.
fms Package fms provides the client and types for making API requests to Firewall Management Service.
fms/fmsiface Package fmsiface provides an interface to enable mocking the Firewall Management Service service client for testing your code.
forecastqueryservice Package forecastqueryservice provides the client and types for making API requests to Amazon Forecast Query Service.
forecastqueryservice/forecastqueryserviceiface Package forecastqueryserviceiface provides an interface to enable mocking the Amazon Forecast Query Service service client for testing your code.
forecastservice Package forecastservice provides the client and types for making API requests to Amazon Forecast Service.
forecastservice/forecastserviceiface Package forecastserviceiface provides an interface to enable mocking the Amazon Forecast Service service client for testing your code.
frauddetector Package frauddetector provides the client and types for making API requests to Amazon Fraud Detector.
frauddetector/frauddetectoriface Package frauddetectoriface provides an interface to enable mocking the Amazon Fraud Detector service client for testing your code.
fsx Package fsx provides the client and types for making API requests to Amazon FSx.
fsx/fsxiface Package fsxiface provides an interface to enable mocking the Amazon FSx service client for testing your code.
gamelift Package gamelift provides the client and types for making API requests to Amazon GameLift.
gamelift/gameliftiface Package gameliftiface provides an interface to enable mocking the Amazon GameLift service client for testing your code.
glacier Package glacier provides the client and types for making API requests to Amazon Glacier.
glacier/glacieriface Package glacieriface provides an interface to enable mocking the Amazon Glacier service client for testing your code.
globalaccelerator Package globalaccelerator provides the client and types for making API requests to AWS Global Accelerator.
globalaccelerator/globalacceleratoriface Package globalacceleratoriface provides an interface to enable mocking the AWS Global Accelerator service client for testing your code.
glue Package glue provides the client and types for making API requests to AWS Glue.
glue/glueiface Package glueiface provides an interface to enable mocking the AWS Glue service client for testing your code.
greengrass Package greengrass provides the client and types for making API requests to AWS Greengrass.
greengrass/greengrassiface Package greengrassiface provides an interface to enable mocking the AWS Greengrass service client for testing your code.
groundstation Package groundstation provides the client and types for making API requests to AWS Ground Station.
groundstation/groundstationiface Package groundstationiface provides an interface to enable mocking the AWS Ground Station service client for testing your code.
guardduty Package guardduty provides the client and types for making API requests to Amazon GuardDuty.
guardduty/guarddutyiface Package guarddutyiface provides an interface to enable mocking the Amazon GuardDuty service client for testing your code.
health Package health provides the client and types for making API requests to AWS Health APIs and Notifications.
health/healthiface Package healthiface provides an interface to enable mocking the AWS Health APIs and Notifications service client for testing your code.
honeycode Package honeycode provides the client and types for making API requests to Amazon Honeycode.
honeycode/honeycodeiface Package honeycodeiface provides an interface to enable mocking the Amazon Honeycode service client for testing your code.
iam Package iam provides the client and types for making API requests to AWS Identity and Access Management.
iam/iamiface Package iamiface provides an interface to enable mocking the AWS Identity and Access Management service client for testing your code.
imagebuilder Package imagebuilder provides the client and types for making API requests to EC2 Image Builder.
imagebuilder/imagebuilderiface Package imagebuilderiface provides an interface to enable mocking the EC2 Image Builder service client for testing your code.
inspector Package inspector provides the client and types for making API requests to Amazon Inspector.
inspector/inspectoriface Package inspectoriface provides an interface to enable mocking the Amazon Inspector service client for testing your code.
iot Package iot provides the client and types for making API requests to AWS IoT. AWS IoT provides secure, bi-directional communication between Internet-connected devices (such as sensors, actuators, embedded devices, or smart appliances) and the AWS cloud.
iot/iotiface Package iotiface provides an interface to enable mocking the AWS IoT service client for testing your code.
iot1clickdevicesservice Package iot1clickdevicesservice provides the client and types for making API requests to AWS IoT 1-Click Devices Service.
iot1clickdevicesservice/iot1clickdevicesserviceiface Package iot1clickdevicesserviceiface provides an interface to enable mocking the AWS IoT 1-Click Devices Service service client for testing your code.
iot1clickprojects Package iot1clickprojects provides the client and types for making API requests to AWS IoT 1-Click Projects Service.
iot1clickprojects/iot1clickprojectsiface Package iot1clickprojectsiface provides an interface to enable mocking the AWS IoT 1-Click Projects Service service client for testing your code.
iotanalytics Package iotanalytics provides the client and types for making API requests to AWS IoT Analytics.
iotanalytics/iotanalyticsiface Package iotanalyticsiface provides an interface to enable mocking the AWS IoT Analytics service client for testing your code.
iotdataplane Package iotdataplane provides the client and types for making API requests to AWS IoT Data Plane.
iotdataplane/iotdataplaneiface Package iotdataplaneiface provides an interface to enable mocking the AWS IoT Data Plane service client for testing your code.
iotevents Package iotevents provides the client and types for making API requests to AWS IoT Events.
iotevents/ioteventsiface Package ioteventsiface provides an interface to enable mocking the AWS IoT Events service client for testing your code.
ioteventsdata Package ioteventsdata provides the client and types for making API requests to AWS IoT Events Data.
ioteventsdata/ioteventsdataiface Package ioteventsdataiface provides an interface to enable mocking the AWS IoT Events Data service client for testing your code.
iotjobsdataplane Package iotjobsdataplane provides the client and types for making API requests to AWS IoT Jobs Data Plane.
iotjobsdataplane/iotjobsdataplaneiface Package iotjobsdataplaneiface provides an interface to enable mocking the AWS IoT Jobs Data Plane service client for testing your code.
iotsecuretunneling Package iotsecuretunneling provides the client and types for making API requests to AWS IoT Secure Tunneling.
iotsecuretunneling/iotsecuretunnelingiface Package iotsecuretunnelingiface provides an interface to enable mocking the AWS IoT Secure Tunneling service client for testing your code.
iotsitewise Package iotsitewise provides the client and types for making API requests to AWS IoT SiteWise.
iotsitewise/iotsitewiseiface Package iotsitewiseiface provides an interface to enable mocking the AWS IoT SiteWise service client for testing your code.
iotthingsgraph Package iotthingsgraph provides the client and types for making API requests to AWS IoT Things Graph.
iotthingsgraph/iotthingsgraphiface Package iotthingsgraphiface provides an interface to enable mocking the AWS IoT Things Graph service client for testing your code.
ivs Package ivs provides the client and types for making API requests to Amazon Interactive Video Service.
ivs/ivsiface Package ivsiface provides an interface to enable mocking the Amazon Interactive Video Service service client for testing your code.
kafka Package kafka provides the client and types for making API requests to Managed Streaming for Kafka.
kafka/kafkaiface Package kafkaiface provides an interface to enable mocking the Managed Streaming for Kafka service client for testing your code.
kendra Package kendra provides the client and types for making API requests to AWSKendraFrontendService.
kendra/kendraiface Package kendraiface provides an interface to enable mocking the AWSKendraFrontendService service client for testing your code.
kinesis Package kinesis provides the client and types for making API requests to Amazon Kinesis.
kinesis/kinesisiface Package kinesisiface provides an interface to enable mocking the Amazon Kinesis service client for testing your code.
kinesisanalytics Package kinesisanalytics provides the client and types for making API requests to Amazon Kinesis Analytics.
kinesisanalytics/kinesisanalyticsiface Package kinesisanalyticsiface provides an interface to enable mocking the Amazon Kinesis Analytics service client for testing your code.
kinesisanalyticsv2 Package kinesisanalyticsv2 provides the client and types for making API requests to Amazon Kinesis Analytics.
kinesisanalyticsv2/kinesisanalyticsv2iface Package kinesisanalyticsv2iface provides an interface to enable mocking the Amazon Kinesis Analytics service client for testing your code.
kinesisvideo Package kinesisvideo provides the client and types for making API requests to Amazon Kinesis Video Streams.
kinesisvideo/kinesisvideoiface Package kinesisvideoiface provides an interface to enable mocking the Amazon Kinesis Video Streams service client for testing your code.
kinesisvideoarchivedmedia Package kinesisvideoarchivedmedia provides the client and types for making API requests to Amazon Kinesis Video Streams Archived Media.
kinesisvideoarchivedmedia/kinesisvideoarchivedmediaiface Package kinesisvideoarchivedmediaiface provides an interface to enable mocking the Amazon Kinesis Video Streams Archived Media service client for testing your code.
kinesisvideomedia Package kinesisvideomedia provides the client and types for making API requests to Amazon Kinesis Video Streams Media.
kinesisvideomedia/kinesisvideomediaiface Package kinesisvideomediaiface provides an interface to enable mocking the Amazon Kinesis Video Streams Media service client for testing your code.
kinesisvideosignalingchannels Package kinesisvideosignalingchannels provides the client and types for making API requests to Amazon Kinesis Video Signaling Channels.
kinesisvideosignalingchannels/kinesisvideosignalingchannelsiface Package kinesisvideosignalingchannelsiface provides an interface to enable mocking the Amazon Kinesis Video Signaling Channels service client for testing your code.
kms Package kms provides the client and types for making API requests to AWS Key Management Service.
kms/kmsiface Package kmsiface provides an interface to enable mocking the AWS Key Management Service service client for testing your code.
lakeformation Package lakeformation provides the client and types for making API requests to AWS Lake Formation.
lakeformation/lakeformationiface Package lakeformationiface provides an interface to enable mocking the AWS Lake Formation service client for testing your code.
lambda Package lambda provides the client and types for making API requests to AWS Lambda.
lambda/lambdaiface Package lambdaiface provides an interface to enable mocking the AWS Lambda service client for testing your code.
lexmodelbuildingservice Package lexmodelbuildingservice provides the client and types for making API requests to Amazon Lex Model Building Service.
lexmodelbuildingservice/lexmodelbuildingserviceiface Package lexmodelbuildingserviceiface provides an interface to enable mocking the Amazon Lex Model Building Service service client for testing your code.
lexruntimeservice Package lexruntimeservice provides the client and types for making API requests to Amazon Lex Runtime Service.
lexruntimeservice/lexruntimeserviceiface Package lexruntimeserviceiface provides an interface to enable mocking the Amazon Lex Runtime Service service client for testing your code.
licensemanager Package licensemanager provides the client and types for making API requests to AWS License Manager.
licensemanager/licensemanageriface Package licensemanageriface provides an interface to enable mocking the AWS License Manager service client for testing your code.
lightsail Package lightsail provides the client and types for making API requests to Amazon Lightsail.
lightsail/lightsailiface Package lightsailiface provides an interface to enable mocking the Amazon Lightsail service client for testing your code.
machinelearning Package machinelearning provides the client and types for making API requests to Amazon Machine Learning.
machinelearning/machinelearningiface Package machinelearningiface provides an interface to enable mocking the Amazon Machine Learning service client for testing your code.
macie Package macie provides the client and types for making API requests to Amazon Macie.
macie/macieiface Package macieiface provides an interface to enable mocking the Amazon Macie service client for testing your code.
macie2 Package macie2 provides the client and types for making API requests to Amazon Macie 2.
macie2/macie2iface Package macie2iface provides an interface to enable mocking the Amazon Macie 2 service client for testing your code.
managedblockchain Package managedblockchain provides the client and types for making API requests to Amazon Managed Blockchain.
managedblockchain/managedblockchainiface Package managedblockchainiface provides an interface to enable mocking the Amazon Managed Blockchain service client for testing your code.
marketplacecatalog Package marketplacecatalog provides the client and types for making API requests to AWS Marketplace Catalog Service.
marketplacecatalog/marketplacecatalogiface Package marketplacecatalogiface provides an interface to enable mocking the AWS Marketplace Catalog Service service client for testing your code.
marketplacecommerceanalytics Package marketplacecommerceanalytics provides the client and types for making API requests to AWS Marketplace Commerce Analytics.
marketplacecommerceanalytics/marketplacecommerceanalyticsiface Package marketplacecommerceanalyticsiface provides an interface to enable mocking the AWS Marketplace Commerce Analytics service client for testing your code.
marketplaceentitlementservice Package marketplaceentitlementservice provides the client and types for making API requests to AWS Marketplace Entitlement Service.
marketplaceentitlementservice/marketplaceentitlementserviceiface Package marketplaceentitlementserviceiface provides an interface to enable mocking the AWS Marketplace Entitlement Service service client for testing your code.
marketplacemetering Package marketplacemetering provides the client and types for making API requests to AWSMarketplace Metering.
marketplacemetering/marketplacemeteringiface Package marketplacemeteringiface provides an interface to enable mocking the AWSMarketplace Metering service client for testing your code.
mediaconnect Package mediaconnect provides the client and types for making API requests to AWS MediaConnect.
mediaconnect/mediaconnectiface Package mediaconnectiface provides an interface to enable mocking the AWS MediaConnect service client for testing your code.
mediaconvert Package mediaconvert provides the client and types for making API requests to AWS Elemental MediaConvert.
mediaconvert/mediaconvertiface Package mediaconvertiface provides an interface to enable mocking the AWS Elemental MediaConvert service client for testing your code.
medialive Package medialive provides the client and types for making API requests to AWS Elemental MediaLive.
medialive/medialiveiface Package medialiveiface provides an interface to enable mocking the AWS Elemental MediaLive service client for testing your code.
mediapackage Package mediapackage provides the client and types for making API requests to AWS Elemental MediaPackage.
mediapackage/mediapackageiface Package mediapackageiface provides an interface to enable mocking the AWS Elemental MediaPackage service client for testing your code.
mediapackagevod Package mediapackagevod provides the client and types for making API requests to AWS Elemental MediaPackage VOD.
mediapackagevod/mediapackagevodiface Package mediapackagevodiface provides an interface to enable mocking the AWS Elemental MediaPackage VOD service client for testing your code.
mediastore Package mediastore provides the client and types for making API requests to AWS Elemental MediaStore.
mediastore/mediastoreiface Package mediastoreiface provides an interface to enable mocking the AWS Elemental MediaStore service client for testing your code.
mediastoredata Package mediastoredata provides the client and types for making API requests to AWS Elemental MediaStore Data Plane.
mediastoredata/mediastoredataiface Package mediastoredataiface provides an interface to enable mocking the AWS Elemental MediaStore Data Plane service client for testing your code.
mediatailor Package mediatailor provides the client and types for making API requests to AWS MediaTailor.
mediatailor/mediatailoriface Package mediatailoriface provides an interface to enable mocking the AWS MediaTailor service client for testing your code.
migrationhub Package migrationhub provides the client and types for making API requests to AWS Migration Hub.
migrationhub/migrationhubiface Package migrationhubiface provides an interface to enable mocking the AWS Migration Hub service client for testing your code.
migrationhubconfig Package migrationhubconfig provides the client and types for making API requests to AWS Migration Hub Config.
migrationhubconfig/migrationhubconfigiface Package migrationhubconfigiface provides an interface to enable mocking the AWS Migration Hub Config service client for testing your code.
mobile Package mobile provides the client and types for making API requests to AWS Mobile.
mobile/mobileiface Package mobileiface provides an interface to enable mocking the AWS Mobile service client for testing your code.
mobileanalytics Package mobileanalytics provides the client and types for making API requests to Amazon Mobile Analytics.
mobileanalytics/mobileanalyticsiface Package mobileanalyticsiface provides an interface to enable mocking the Amazon Mobile Analytics service client for testing your code.
mq Package mq provides the client and types for making API requests to AmazonMQ.
mq/mqiface Package mqiface provides an interface to enable mocking the AmazonMQ service client for testing your code.
mturk Package mturk provides the client and types for making API requests to Amazon Mechanical Turk.
mturk/mturkiface Package mturkiface provides an interface to enable mocking the Amazon Mechanical Turk service client for testing your code.
neptune Package neptune provides the client and types for making API requests to Amazon Neptune.
neptune/neptuneiface Package neptuneiface provides an interface to enable mocking the Amazon Neptune service client for testing your code.
networkmanager Package networkmanager provides the client and types for making API requests to AWS Network Manager.
networkmanager/networkmanageriface Package networkmanageriface provides an interface to enable mocking the AWS Network Manager service client for testing your code.
opsworks Package opsworks provides the client and types for making API requests to AWS OpsWorks.
opsworks/opsworksiface Package opsworksiface provides an interface to enable mocking the AWS OpsWorks service client for testing your code.
opsworkscm Package opsworkscm provides the client and types for making API requests to AWS OpsWorks CM.
opsworkscm/opsworkscmiface Package opsworkscmiface provides an interface to enable mocking the AWS OpsWorks CM service client for testing your code.
organizations Package organizations provides the client and types for making API requests to AWS Organizations.
organizations/organizationsiface Package organizationsiface provides an interface to enable mocking the AWS Organizations service client for testing your code.
outposts Package outposts provides the client and types for making API requests to AWS Outposts.
outposts/outpostsiface Package outpostsiface provides an interface to enable mocking the AWS Outposts service client for testing your code.
personalize Package personalize provides the client and types for making API requests to Amazon Personalize.
personalize/personalizeiface Package personalizeiface provides an interface to enable mocking the Amazon Personalize service client for testing your code.
personalizeevents Package personalizeevents provides the client and types for making API requests to Amazon Personalize Events.
personalizeevents/personalizeeventsiface Package personalizeeventsiface provides an interface to enable mocking the Amazon Personalize Events service client for testing your code.
personalizeruntime Package personalizeruntime provides the client and types for making API requests to Amazon Personalize Runtime.
personalizeruntime/personalizeruntimeiface Package personalizeruntimeiface provides an interface to enable mocking the Amazon Personalize Runtime service client for testing your code.
pi Package pi provides the client and types for making API requests to AWS Performance Insights.
pi/piiface Package piiface provides an interface to enable mocking the AWS Performance Insights service client for testing your code.
pinpoint Package pinpoint provides the client and types for making API requests to Amazon Pinpoint.
pinpoint/pinpointiface Package pinpointiface provides an interface to enable mocking the Amazon Pinpoint service client for testing your code.
pinpointemail Package pinpointemail provides the client and types for making API requests to Amazon Pinpoint Email Service.
pinpointemail/pinpointemailiface Package pinpointemailiface provides an interface to enable mocking the Amazon Pinpoint Email Service service client for testing your code.
pinpointsmsvoice Package pinpointsmsvoice provides the client and types for making API requests to Amazon Pinpoint SMS and Voice Service.
pinpointsmsvoice/pinpointsmsvoiceiface Package pinpointsmsvoiceiface provides an interface to enable mocking the Amazon Pinpoint SMS and Voice Service service client for testing your code.
polly Package polly provides the client and types for making API requests to Amazon Polly.
polly/pollyiface Package pollyiface provides an interface to enable mocking the Amazon Polly service client for testing your code.
pricing Package pricing provides the client and types for making API requests to AWS Price List Service.
pricing/pricingiface Package pricingiface provides an interface to enable mocking the AWS Price List Service service client for testing your code.
qldb Package qldb provides the client and types for making API requests to Amazon QLDB.
qldb/qldbiface Package qldbiface provides an interface to enable mocking the Amazon QLDB service client for testing your code.
qldbsession Package qldbsession provides the client and types for making API requests to Amazon QLDB Session.
qldbsession/qldbsessioniface Package qldbsessioniface provides an interface to enable mocking the Amazon QLDB Session service client for testing your code.
quicksight Package quicksight provides the client and types for making API requests to Amazon QuickSight.
quicksight/quicksightiface Package quicksightiface provides an interface to enable mocking the Amazon QuickSight service client for testing your code.
ram Package ram provides the client and types for making API requests to AWS Resource Access Manager.
ram/ramiface Package ramiface provides an interface to enable mocking the AWS Resource Access Manager service client for testing your code.
rds Package rds provides the client and types for making API requests to Amazon Relational Database Service.
rds/rdsiface Package rdsiface provides an interface to enable mocking the Amazon Relational Database Service service client for testing your code.
rds/rdsutils Package rdsutils is used to generate authentication tokens used to connect to a givent Amazon Relational Database Service (RDS) database.
rdsdataservice Package rdsdataservice provides the client and types for making API requests to AWS RDS DataService.
rdsdataservice/rdsdataserviceiface Package rdsdataserviceiface provides an interface to enable mocking the AWS RDS DataService service client for testing your code.
redshift Package redshift provides the client and types for making API requests to Amazon Redshift.
redshift/redshiftiface Package redshiftiface provides an interface to enable mocking the Amazon Redshift service client for testing your code.
rekognition Package rekognition provides the client and types for making API requests to Amazon Rekognition.
rekognition/rekognitioniface Package rekognitioniface provides an interface to enable mocking the Amazon Rekognition service client for testing your code.
resourcegroups Package resourcegroups provides the client and types for making API requests to AWS Resource Groups.
resourcegroups/resourcegroupsiface Package resourcegroupsiface provides an interface to enable mocking the AWS Resource Groups service client for testing your code.
resourcegroupstaggingapi Package resourcegroupstaggingapi provides the client and types for making API requests to AWS Resource Groups Tagging API.
resourcegroupstaggingapi/resourcegroupstaggingapiiface Package resourcegroupstaggingapiiface provides an interface to enable mocking the AWS Resource Groups Tagging API service client for testing your code.
robomaker Package robomaker provides the client and types for making API requests to AWS RoboMaker.
robomaker/robomakeriface Package robomakeriface provides an interface to enable mocking the AWS RoboMaker service client for testing your code.
route53 Package route53 provides the client and types for making API requests to Amazon Route 53.
route53/route53iface Package route53iface provides an interface to enable mocking the Amazon Route 53 service client for testing your code.
route53domains Package route53domains provides the client and types for making API requests to Amazon Route 53 Domains.
route53domains/route53domainsiface Package route53domainsiface provides an interface to enable mocking the Amazon Route 53 Domains service client for testing your code.
route53resolver Package route53resolver provides the client and types for making API requests to Amazon Route 53 Resolver.
route53resolver/route53resolveriface Package route53resolveriface provides an interface to enable mocking the Amazon Route 53 Resolver service client for testing your code.
s3 Package s3 provides the client and types for making API requests to Amazon Simple Storage Service.
s3/internal/arn
s3/internal/s3testing
s3/s3crypto Package s3crypto provides encryption to S3 using KMS and AES GCM.
s3/s3iface Package s3iface provides an interface to enable mocking the Amazon Simple Storage Service service client for testing your code.
s3/s3manager Package s3manager provides utilities to upload and download objects from S3 concurrently.
s3/s3manager/s3manageriface Package s3manageriface provides an interface for the s3manager package
s3control Package s3control provides the client and types for making API requests to AWS S3 Control.
s3control/s3controliface Package s3controliface provides an interface to enable mocking the AWS S3 Control service client for testing your code.
sagemaker Package sagemaker provides the client and types for making API requests to Amazon SageMaker Service.
sagemaker/sagemakeriface Package sagemakeriface provides an interface to enable mocking the Amazon SageMaker Service service client for testing your code.
sagemakerruntime Package sagemakerruntime provides the client and types for making API requests to Amazon SageMaker Runtime.
sagemakerruntime/sagemakerruntimeiface Package sagemakerruntimeiface provides an interface to enable mocking the Amazon SageMaker Runtime service client for testing your code.
savingsplans Package savingsplans provides the client and types for making API requests to AWS Savings Plans.
savingsplans/savingsplansiface Package savingsplansiface provides an interface to enable mocking the AWS Savings Plans service client for testing your code.
schemas Package schemas provides the client and types for making API requests to Schemas.
schemas/schemasiface Package schemasiface provides an interface to enable mocking the Schemas service client for testing your code.
secretsmanager Package secretsmanager provides the client and types for making API requests to AWS Secrets Manager.
secretsmanager/secretsmanageriface Package secretsmanageriface provides an interface to enable mocking the AWS Secrets Manager service client for testing your code.
securityhub Package securityhub provides the client and types for making API requests to AWS SecurityHub.
securityhub/securityhubiface Package securityhubiface provides an interface to enable mocking the AWS SecurityHub service client for testing your code.
serverlessapplicationrepository Package serverlessapplicationrepository provides the client and types for making API requests to AWSServerlessApplicationRepository.
serverlessapplicationrepository/serverlessapplicationrepositoryiface Package serverlessapplicationrepositoryiface provides an interface to enable mocking the AWSServerlessApplicationRepository service client for testing your code.
servicecatalog Package servicecatalog provides the client and types for making API requests to AWS Service Catalog.
servicecatalog/servicecatalogiface Package servicecatalogiface provides an interface to enable mocking the AWS Service Catalog service client for testing your code.
servicediscovery Package servicediscovery provides the client and types for making API requests to AWS Cloud Map.
servicediscovery/servicediscoveryiface Package servicediscoveryiface provides an interface to enable mocking the AWS Cloud Map service client for testing your code.
servicequotas Package servicequotas provides the client and types for making API requests to Service Quotas.
servicequotas/servicequotasiface Package servicequotasiface provides an interface to enable mocking the Service Quotas service client for testing your code.
ses Package ses provides the client and types for making API requests to Amazon Simple Email Service.
ses/sesiface Package sesiface provides an interface to enable mocking the Amazon Simple Email Service service client for testing your code.
sesv2 Package sesv2 provides the client and types for making API requests to Amazon Simple Email Service.
sesv2/sesv2iface Package sesv2iface provides an interface to enable mocking the Amazon Simple Email Service service client for testing your code.
sfn Package sfn provides the client and types for making API requests to AWS Step Functions.
sfn/sfniface Package sfniface provides an interface to enable mocking the AWS Step Functions service client for testing your code.
shield Package shield provides the client and types for making API requests to AWS Shield.
shield/shieldiface Package shieldiface provides an interface to enable mocking the AWS Shield service client for testing your code.
signer Package signer provides the client and types for making API requests to AWS Signer.
signer/signeriface Package signeriface provides an interface to enable mocking the AWS Signer service client for testing your code.
simpledb Package simpledb provides the client and types for making API requests to Amazon SimpleDB.
simpledb/simpledbiface Package simpledbiface provides an interface to enable mocking the Amazon SimpleDB service client for testing your code.
sms Package sms provides the client and types for making API requests to AWS Server Migration Service.
sms/smsiface Package smsiface provides an interface to enable mocking the AWS Server Migration Service service client for testing your code.
snowball Package snowball provides the client and types for making API requests to Amazon Import/Export Snowball.
snowball/snowballiface Package snowballiface provides an interface to enable mocking the Amazon Import/Export Snowball service client for testing your code.
sns Package sns provides the client and types for making API requests to Amazon Simple Notification Service.
sns/snsiface Package snsiface provides an interface to enable mocking the Amazon Simple Notification Service service client for testing your code.
sqs Package sqs provides the client and types for making API requests to Amazon Simple Queue Service.
sqs/sqsiface Package sqsiface provides an interface to enable mocking the Amazon Simple Queue Service service client for testing your code.
ssm Package ssm provides the client and types for making API requests to Amazon Simple Systems Manager (SSM).
ssm/ssmiface Package ssmiface provides an interface to enable mocking the Amazon Simple Systems Manager (SSM) service client for testing your code.
sso Package sso provides the client and types for making API requests to AWS Single Sign-On.
sso/ssoiface Package ssoiface provides an interface to enable mocking the AWS Single Sign-On service client for testing your code.
ssooidc Package ssooidc provides the client and types for making API requests to AWS SSO OIDC.
ssooidc/ssooidciface Package ssooidciface provides an interface to enable mocking the AWS SSO OIDC service client for testing your code.
storagegateway Package storagegateway provides the client and types for making API requests to AWS Storage Gateway.
storagegateway/storagegatewayiface Package storagegatewayiface provides an interface to enable mocking the AWS Storage Gateway service client for testing your code.
sts Package sts provides the client and types for making API requests to AWS Security Token Service.
sts/stsiface Package stsiface provides an interface to enable mocking the AWS Security Token Service service client for testing your code.
support Package support provides the client and types for making API requests to AWS Support.
support/supportiface Package supportiface provides an interface to enable mocking the AWS Support service client for testing your code.
swf Package swf provides the client and types for making API requests to Amazon Simple Workflow Service.
swf/swfiface Package swfiface provides an interface to enable mocking the Amazon Simple Workflow Service service client for testing your code.
synthetics Package synthetics provides the client and types for making API requests to Synthetics.
synthetics/syntheticsiface Package syntheticsiface provides an interface to enable mocking the Synthetics service client for testing your code.
textract Package textract provides the client and types for making API requests to Amazon Textract.
textract/textractiface Package textractiface provides an interface to enable mocking the Amazon Textract service client for testing your code.
transcribeservice Package transcribeservice provides the client and types for making API requests to Amazon Transcribe Service.
transcribeservice/transcribeserviceiface Package transcribeserviceiface provides an interface to enable mocking the Amazon Transcribe Service service client for testing your code.
transcribestreamingservice Package transcribestreamingservice provides the client and types for making API requests to Amazon Transcribe Streaming Service.
transcribestreamingservice/transcribestreamingserviceiface Package transcribestreamingserviceiface provides an interface to enable mocking the Amazon Transcribe Streaming Service service client for testing your code.
transfer Package transfer provides the client and types for making API requests to AWS Transfer Family.
transfer/transferiface Package transferiface provides an interface to enable mocking the AWS Transfer Family service client for testing your code.
translate Package translate provides the client and types for making API requests to Amazon Translate.
translate/translateiface Package translateiface provides an interface to enable mocking the Amazon Translate service client for testing your code.
waf Package waf provides the client and types for making API requests to AWS WAF.
waf/wafiface Package wafiface provides an interface to enable mocking the AWS WAF service client for testing your code.
wafregional Package wafregional provides the client and types for making API requests to AWS WAF Regional.
wafregional/wafregionaliface Package wafregionaliface provides an interface to enable mocking the AWS WAF Regional service client for testing your code.
wafv2 Package wafv2 provides the client and types for making API requests to AWS WAFV2.
wafv2/wafv2iface Package wafv2iface provides an interface to enable mocking the AWS WAFV2 service client for testing your code.
workdocs Package workdocs provides the client and types for making API requests to Amazon WorkDocs.
workdocs/workdocsiface Package workdocsiface provides an interface to enable mocking the Amazon WorkDocs service client for testing your code.
worklink Package worklink provides the client and types for making API requests to Amazon WorkLink.
worklink/worklinkiface Package worklinkiface provides an interface to enable mocking the Amazon WorkLink service client for testing your code.
workmail Package workmail provides the client and types for making API requests to Amazon WorkMail.
workmail/workmailiface Package workmailiface provides an interface to enable mocking the Amazon WorkMail service client for testing your code.
workmailmessageflow Package workmailmessageflow provides the client and types for making API requests to Amazon WorkMail Message Flow.
workmailmessageflow/workmailmessageflowiface Package workmailmessageflowiface provides an interface to enable mocking the Amazon WorkMail Message Flow service client for testing your code.
workspaces Package workspaces provides the client and types for making API requests to Amazon WorkSpaces.
workspaces/workspacesiface Package workspacesiface provides an interface to enable mocking the Amazon WorkSpaces service client for testing your code.
xray Package xray provides the client and types for making API requests to AWS X-Ray.
xray/xrayiface Package xrayiface provides an interface to enable mocking the AWS X-Ray service client for testing your code.