Documentation
¶
Overview ¶
Package sdk is the official AWS SDK v2 for the Go programming language.
aws-sdk-go-v2 is the Developer Preview for the v2 of the AWS SDK for the Go programming language. Look for additional documentation and examples to be added.
Getting started ¶
The best way to get started working with the SDK is to use `go get` to add the SDK to your Go Workspace manually.
go get github.com/aws/aws-sdk-go-v2
You could also use [Dep] to add the SDK to your application's dependencies. Using [Dep] will simplify your update story and help your application keep pinned to specific version of the SDK
dep ensure --add github.com/aws/aws-sdk-go-v2
### Hello AWS
This example shows how you can use the v2 SDK to make an API request using the SDK's Amazon DynamoDB client.
package main
import (
"github.com/aws/aws-sdk-go-v2/aws"
"github.com/aws/aws-sdk-go-v2/aws/endpoints"
"github.com/aws/aws-sdk-go-v2/aws/external"
"github.com/aws/aws-sdk-go-v2/service/dynamodb"
)
func main() {
// Using the SDK's default configuration, loading additional config
// and credentials values from the environment variables, shared
// credentials, and shared configuration files
cfg, err := external.LoadDefaultAWSConfig()
if err != nil {
panic("unable to load SDK config, " + err.Error())
}
// Set the AWS Region that the service clients should use
cfg.Region = endpoints.UsWest2RegionID
// Using the Config value, create the DynamoDB client
svc := dynamodb.New(cfg)
// Build the request with its input parameters
req := svc.DescribeTableRequest(&dynamodb.DescribeTableInput{
TableName: aws.String("myTable"),
})
// Send the request, and get the response or error back
resp, err := req.Send()
if err != nil {
panic("failed to describe table, "+err.Error())
}
fmt.Println("Response", resp)
}
Directories
¶
| Path | Synopsis |
|---|---|
|
Package aws provides the core SDK's utilities and shared types.
|
Package aws provides the core SDK's utilities and shared types. |
|
arn
Package arn provides a parser for interacting with Amazon Resource Names.
|
Package arn provides a parser for interacting with Amazon Resource Names. |
|
awserr
Package awserr represents API error interface accessors for the SDK.
|
Package awserr represents API error interface accessors for the SDK. |
|
defaults
Package defaults is a collection of helpers to retrieve the SDK's default configuration and handlers.
|
Package defaults is a collection of helpers to retrieve the SDK's default configuration and handlers. |
|
ec2metadata
Package ec2metadata provides the client for making API calls to the EC2 Metadata service.
|
Package ec2metadata provides the client for making API calls to the EC2 Metadata service. |
|
endpointcreds
Package endpointcreds provides support for retrieving credentials from an arbitrary HTTP endpoint.
|
Package endpointcreds provides support for retrieving credentials from an arbitrary HTTP endpoint. |
|
endpoints
Package endpoints provides the types and functionality for defining regions and endpoints, as well as querying those definitions.
|
Package endpoints provides the types and functionality for defining regions and endpoints, as well as querying those definitions. |
|
plugincreds
Package plugincreds implements a credentials provider sourced from a Go plugin.
|
Package plugincreds implements a credentials provider sourced from a Go plugin. |
|
signer/v4
Package v4 implements signing for AWS V4 signer Provides request signing for request that need to be signed with AWS V4 Signatures.
|
Package v4 implements signing for AWS V4 signer Provides request signing for request that need to be signed with AWS V4 Signatures. |
|
stscreds
Package stscreds are credential Providers to retrieve STS AWS credentials.
|
Package stscreds are credential Providers to retrieve STS AWS credentials. |
|
config
module
|
|
|
credentials
module
|
|
|
feature
|
|
|
ec2/imds
module
|
|
|
internal
|
|
|
awstesting/cmd/op_crawler
command
|
|
|
awstesting/unit
Package unit performs initialization and validation for unit tests
|
Package unit performs initialization and validation for unit tests |
|
configsources
module
|
|
|
endpoints
module
|
|
|
ini
module
|
|
|
models
|
|
|
endpoints
Package endpoints contains the models for endpoints that should be used to generate endpoint definition files for the SDK.
|
Package endpoints contains the models for endpoints that should be used to generate endpoint definition files for the SDK. |
|
private
|
|
|
protocol/ec2query
Package ec2query provides serialization of AWS EC2 requests and responses.
|
Package ec2query provides serialization of AWS EC2 requests and responses. |
|
protocol/json/jsonutil
Package jsonutil provides JSON serialization of AWS requests and responses.
|
Package jsonutil provides JSON serialization of AWS requests and responses. |
|
protocol/jsonrpc
Package jsonrpc provides JSON RPC utilities for serialization of AWS requests and responses.
|
Package jsonrpc provides JSON RPC utilities for serialization of AWS requests and responses. |
|
protocol/query
Package query provides serialization of AWS query requests, and responses.
|
Package query provides serialization of AWS query requests, and responses. |
|
protocol/rest
Package rest provides RESTful serialization of AWS requests and responses.
|
Package rest provides RESTful serialization of AWS requests and responses. |
|
protocol/restjson
Package restjson provides RESTful JSON serialization of AWS requests and responses.
|
Package restjson provides RESTful JSON serialization of AWS requests and responses. |
|
protocol/restxml
Package restxml provides RESTful XML serialization of AWS requests and responses.
|
Package restxml provides RESTful XML serialization of AWS requests and responses. |
|
protocol/xml/xmlutil
Package xmlutil provides XML serialization of AWS requests and responses.
|
Package xmlutil provides XML serialization of AWS requests and responses. |
|
Package service contains automatically generated AWS clients.
|
Package service contains automatically generated AWS clients. |
|
acm
Package acm provides the client and types for making API requests to AWS Certificate Manager.
|
Package acm provides the client and types for making API requests to AWS Certificate Manager. |
|
acm/acmiface
Package acmiface provides an interface to enable mocking the AWS Certificate Manager service client for testing your code.
|
Package acmiface provides an interface to enable mocking the AWS Certificate Manager service client for testing your code. |
|
acmpca
Package acmpca provides the client and types for making API requests to AWS Certificate Manager Private Certificate Authority.
|
Package acmpca provides the client and types for making API requests to AWS Certificate Manager Private Certificate Authority. |
|
acmpca/acmpcaiface
Package acmpcaiface provides an interface to enable mocking the AWS Certificate Manager Private Certificate Authority service client for testing your code.
|
Package acmpcaiface provides an interface to enable mocking the AWS Certificate Manager Private Certificate Authority service client for testing your code. |
|
alexaforbusiness
Package alexaforbusiness provides the client and types for making API requests to Alexa For Business.
|
Package alexaforbusiness provides the client and types for making API requests to Alexa For Business. |
|
alexaforbusiness/alexaforbusinessiface
Package alexaforbusinessiface provides an interface to enable mocking the Alexa For Business service client for testing your code.
|
Package alexaforbusinessiface provides an interface to enable mocking the Alexa For Business service client for testing your code. |
|
apigateway
Package apigateway provides the client and types for making API requests to Amazon API Gateway.
|
Package apigateway provides the client and types for making API requests to Amazon API Gateway. |
|
apigateway/apigatewayiface
Package apigatewayiface provides an interface to enable mocking the Amazon API Gateway service client for testing your code.
|
Package apigatewayiface provides an interface to enable mocking the Amazon API Gateway service client for testing your code. |
|
applicationautoscaling
Package applicationautoscaling provides the client and types for making API requests to Application Auto Scaling.
|
Package applicationautoscaling provides the client and types for making API requests to Application Auto Scaling. |
|
applicationautoscaling/applicationautoscalingiface
Package applicationautoscalingiface provides an interface to enable mocking the Application Auto Scaling service client for testing your code.
|
Package applicationautoscalingiface provides an interface to enable mocking the Application Auto Scaling service client for testing your code. |
|
applicationdiscoveryservice
Package applicationdiscoveryservice provides the client and types for making API requests to AWS Application Discovery Service.
|
Package applicationdiscoveryservice provides the client and types for making API requests to AWS Application Discovery Service. |
|
applicationdiscoveryservice/applicationdiscoveryserviceiface
Package applicationdiscoveryserviceiface provides an interface to enable mocking the AWS Application Discovery Service service client for testing your code.
|
Package applicationdiscoveryserviceiface provides an interface to enable mocking the AWS Application Discovery Service service client for testing your code. |
|
appstream
Package appstream provides the client and types for making API requests to Amazon AppStream.
|
Package appstream provides the client and types for making API requests to Amazon AppStream. |
|
appstream/appstreamiface
Package appstreamiface provides an interface to enable mocking the Amazon AppStream service client for testing your code.
|
Package appstreamiface provides an interface to enable mocking the Amazon AppStream service client for testing your code. |
|
appsync
Package appsync provides the client and types for making API requests to AWS AppSync.
|
Package appsync provides the client and types for making API requests to AWS AppSync. |
|
appsync/appsynciface
Package appsynciface provides an interface to enable mocking the AWS AppSync service client for testing your code.
|
Package appsynciface provides an interface to enable mocking the AWS AppSync service client for testing your code. |
|
athena
Package athena provides the client and types for making API requests to Amazon Athena.
|
Package athena provides the client and types for making API requests to Amazon Athena. |
|
athena/athenaiface
Package athenaiface provides an interface to enable mocking the Amazon Athena service client for testing your code.
|
Package athenaiface provides an interface to enable mocking the Amazon Athena service client for testing your code. |
|
autoscaling
Package autoscaling provides the client and types for making API requests to Auto Scaling.
|
Package autoscaling provides the client and types for making API requests to Auto Scaling. |
|
autoscaling/autoscalingiface
Package autoscalingiface provides an interface to enable mocking the Auto Scaling service client for testing your code.
|
Package autoscalingiface provides an interface to enable mocking the Auto Scaling service client for testing your code. |
|
autoscalingplans
Package autoscalingplans provides the client and types for making API requests to AWS Auto Scaling Plans.
|
Package autoscalingplans provides the client and types for making API requests to AWS Auto Scaling Plans. |
|
autoscalingplans/autoscalingplansiface
Package autoscalingplansiface provides an interface to enable mocking the AWS Auto Scaling Plans service client for testing your code.
|
Package autoscalingplansiface provides an interface to enable mocking the AWS Auto Scaling Plans service client for testing your code. |
|
batch
Package batch provides the client and types for making API requests to AWS Batch.
|
Package batch provides the client and types for making API requests to AWS Batch. |
|
batch/batchiface
Package batchiface provides an interface to enable mocking the AWS Batch service client for testing your code.
|
Package batchiface provides an interface to enable mocking the AWS Batch service client for testing your code. |
|
budgets
Package budgets provides the client and types for making API requests to AWS Budgets.
|
Package budgets provides the client and types for making API requests to AWS Budgets. |
|
budgets/budgetsiface
Package budgetsiface provides an interface to enable mocking the AWS Budgets service client for testing your code.
|
Package budgetsiface provides an interface to enable mocking the AWS Budgets service client for testing your code. |
|
cloud9
Package cloud9 provides the client and types for making API requests to AWS Cloud9.
|
Package cloud9 provides the client and types for making API requests to AWS Cloud9. |
|
cloud9/cloud9iface
Package cloud9iface provides an interface to enable mocking the AWS Cloud9 service client for testing your code.
|
Package cloud9iface provides an interface to enable mocking the AWS Cloud9 service client for testing your code. |
|
clouddirectory
Package clouddirectory provides the client and types for making API requests to Amazon CloudDirectory.
|
Package clouddirectory provides the client and types for making API requests to Amazon CloudDirectory. |
|
clouddirectory/clouddirectoryiface
Package clouddirectoryiface provides an interface to enable mocking the Amazon CloudDirectory service client for testing your code.
|
Package clouddirectoryiface provides an interface to enable mocking the Amazon CloudDirectory service client for testing your code. |
|
cloudformation
Package cloudformation provides the client and types for making API requests to AWS CloudFormation.
|
Package cloudformation provides the client and types for making API requests to AWS CloudFormation. |
|
cloudformation/cloudformationiface
Package cloudformationiface provides an interface to enable mocking the AWS CloudFormation service client for testing your code.
|
Package cloudformationiface provides an interface to enable mocking the AWS CloudFormation service client for testing your code. |
|
cloudfront
Package cloudfront provides the client and types for making API requests to Amazon CloudFront.
|
Package cloudfront provides the client and types for making API requests to Amazon CloudFront. |
|
cloudfront/cloudfrontiface
Package cloudfrontiface provides an interface to enable mocking the Amazon CloudFront service client for testing your code.
|
Package cloudfrontiface provides an interface to enable mocking the Amazon CloudFront service client for testing your code. |
|
cloudfront/sign
Package sign provides utilities to generate signed URLs for Amazon CloudFront.
|
Package sign provides utilities to generate signed URLs for Amazon CloudFront. |
|
cloudhsm
Package cloudhsm provides the client and types for making API requests to Amazon CloudHSM.
|
Package cloudhsm provides the client and types for making API requests to Amazon CloudHSM. |
|
cloudhsm/cloudhsmiface
Package cloudhsmiface provides an interface to enable mocking the Amazon CloudHSM service client for testing your code.
|
Package cloudhsmiface provides an interface to enable mocking the Amazon CloudHSM service client for testing your code. |
|
cloudhsmv2
Package cloudhsmv2 provides the client and types for making API requests to AWS CloudHSM V2.
|
Package cloudhsmv2 provides the client and types for making API requests to AWS CloudHSM V2. |
|
cloudhsmv2/cloudhsmv2iface
Package cloudhsmv2iface provides an interface to enable mocking the AWS CloudHSM V2 service client for testing your code.
|
Package cloudhsmv2iface provides an interface to enable mocking the AWS CloudHSM V2 service client for testing your code. |
|
cloudsearch
Package cloudsearch provides the client and types for making API requests to Amazon CloudSearch.
|
Package cloudsearch provides the client and types for making API requests to Amazon CloudSearch. |
|
cloudsearch/cloudsearchiface
Package cloudsearchiface provides an interface to enable mocking the Amazon CloudSearch service client for testing your code.
|
Package cloudsearchiface provides an interface to enable mocking the Amazon CloudSearch service client for testing your code. |
|
cloudsearchdomain
Package cloudsearchdomain provides the client and types for making API requests to Amazon CloudSearch Domain.
|
Package cloudsearchdomain provides the client and types for making API requests to Amazon CloudSearch Domain. |
|
cloudsearchdomain/cloudsearchdomainiface
Package cloudsearchdomainiface provides an interface to enable mocking the Amazon CloudSearch Domain service client for testing your code.
|
Package cloudsearchdomainiface provides an interface to enable mocking the Amazon CloudSearch Domain service client for testing your code. |
|
cloudtrail
Package cloudtrail provides the client and types for making API requests to AWS CloudTrail.
|
Package cloudtrail provides the client and types for making API requests to AWS CloudTrail. |
|
cloudtrail/cloudtrailiface
Package cloudtrailiface provides an interface to enable mocking the AWS CloudTrail service client for testing your code.
|
Package cloudtrailiface provides an interface to enable mocking the AWS CloudTrail service client for testing your code. |
|
cloudwatch
Package cloudwatch provides the client and types for making API requests to Amazon CloudWatch.
|
Package cloudwatch provides the client and types for making API requests to Amazon CloudWatch. |
|
cloudwatch/cloudwatchiface
Package cloudwatchiface provides an interface to enable mocking the Amazon CloudWatch service client for testing your code.
|
Package cloudwatchiface provides an interface to enable mocking the Amazon CloudWatch service client for testing your code. |
|
cloudwatchevents
Package cloudwatchevents provides the client and types for making API requests to Amazon CloudWatch Events.
|
Package cloudwatchevents provides the client and types for making API requests to Amazon CloudWatch Events. |
|
cloudwatchevents/cloudwatcheventsiface
Package cloudwatcheventsiface provides an interface to enable mocking the Amazon CloudWatch Events service client for testing your code.
|
Package cloudwatcheventsiface provides an interface to enable mocking the Amazon CloudWatch Events service client for testing your code. |
|
cloudwatchlogs
Package cloudwatchlogs provides the client and types for making API requests to Amazon CloudWatch Logs.
|
Package cloudwatchlogs provides the client and types for making API requests to Amazon CloudWatch Logs. |
|
cloudwatchlogs/cloudwatchlogsiface
Package cloudwatchlogsiface provides an interface to enable mocking the Amazon CloudWatch Logs service client for testing your code.
|
Package cloudwatchlogsiface provides an interface to enable mocking the Amazon CloudWatch Logs service client for testing your code. |
|
codebuild
Package codebuild provides the client and types for making API requests to AWS CodeBuild.
|
Package codebuild provides the client and types for making API requests to AWS CodeBuild. |
|
codebuild/codebuildiface
Package codebuildiface provides an interface to enable mocking the AWS CodeBuild service client for testing your code.
|
Package codebuildiface provides an interface to enable mocking the AWS CodeBuild service client for testing your code. |
|
codecommit
Package codecommit provides the client and types for making API requests to AWS CodeCommit.
|
Package codecommit provides the client and types for making API requests to AWS CodeCommit. |
|
codecommit/codecommitiface
Package codecommitiface provides an interface to enable mocking the AWS CodeCommit service client for testing your code.
|
Package codecommitiface provides an interface to enable mocking the AWS CodeCommit service client for testing your code. |
|
codedeploy
Package codedeploy provides the client and types for making API requests to AWS CodeDeploy.
|
Package codedeploy provides the client and types for making API requests to AWS CodeDeploy. |
|
codedeploy/codedeployiface
Package codedeployiface provides an interface to enable mocking the AWS CodeDeploy service client for testing your code.
|
Package codedeployiface provides an interface to enable mocking the AWS CodeDeploy service client for testing your code. |
|
codepipeline
Package codepipeline provides the client and types for making API requests to AWS CodePipeline.
|
Package codepipeline provides the client and types for making API requests to AWS CodePipeline. |
|
codepipeline/codepipelineiface
Package codepipelineiface provides an interface to enable mocking the AWS CodePipeline service client for testing your code.
|
Package codepipelineiface provides an interface to enable mocking the AWS CodePipeline service client for testing your code. |
|
codestar
Package codestar provides the client and types for making API requests to AWS CodeStar.
|
Package codestar provides the client and types for making API requests to AWS CodeStar. |
|
codestar/codestariface
Package codestariface provides an interface to enable mocking the AWS CodeStar service client for testing your code.
|
Package codestariface provides an interface to enable mocking the AWS CodeStar service client for testing your code. |
|
cognitoidentity
Package cognitoidentity provides the client and types for making API requests to Amazon Cognito Identity.
|
Package cognitoidentity provides the client and types for making API requests to Amazon Cognito Identity. |
|
cognitoidentity/cognitoidentityiface
Package cognitoidentityiface provides an interface to enable mocking the Amazon Cognito Identity service client for testing your code.
|
Package cognitoidentityiface provides an interface to enable mocking the Amazon Cognito Identity service client for testing your code. |
|
cognitoidentityprovider
Package cognitoidentityprovider provides the client and types for making API requests to Amazon Cognito Identity Provider.
|
Package cognitoidentityprovider provides the client and types for making API requests to Amazon Cognito Identity Provider. |
|
cognitoidentityprovider/cognitoidentityprovideriface
Package cognitoidentityprovideriface provides an interface to enable mocking the Amazon Cognito Identity Provider service client for testing your code.
|
Package cognitoidentityprovideriface provides an interface to enable mocking the Amazon Cognito Identity Provider service client for testing your code. |
|
cognitosync
Package cognitosync provides the client and types for making API requests to Amazon Cognito Sync.
|
Package cognitosync provides the client and types for making API requests to Amazon Cognito Sync. |
|
cognitosync/cognitosynciface
Package cognitosynciface provides an interface to enable mocking the Amazon Cognito Sync service client for testing your code.
|
Package cognitosynciface provides an interface to enable mocking the Amazon Cognito Sync service client for testing your code. |
|
comprehend
Package comprehend provides the client and types for making API requests to Amazon Comprehend.
|
Package comprehend provides the client and types for making API requests to Amazon Comprehend. |
|
comprehend/comprehendiface
Package comprehendiface provides an interface to enable mocking the Amazon Comprehend service client for testing your code.
|
Package comprehendiface provides an interface to enable mocking the Amazon Comprehend service client for testing your code. |
|
configservice
Package configservice provides the client and types for making API requests to AWS Config.
|
Package configservice provides the client and types for making API requests to AWS Config. |
|
configservice/configserviceiface
Package configserviceiface provides an interface to enable mocking the AWS Config service client for testing your code.
|
Package configserviceiface provides an interface to enable mocking the AWS Config service client for testing your code. |
|
connect
Package connect provides the client and types for making API requests to Amazon Connect Service.
|
Package connect provides the client and types for making API requests to Amazon Connect Service. |
|
connect/connectiface
Package connectiface provides an interface to enable mocking the Amazon Connect Service service client for testing your code.
|
Package connectiface provides an interface to enable mocking the Amazon Connect Service service client for testing your code. |
|
costandusagereportservice
Package costandusagereportservice provides the client and types for making API requests to AWS Cost and Usage Report Service.
|
Package costandusagereportservice provides the client and types for making API requests to AWS Cost and Usage Report Service. |
|
costandusagereportservice/costandusagereportserviceiface
Package costandusagereportserviceiface provides an interface to enable mocking the AWS Cost and Usage Report Service service client for testing your code.
|
Package costandusagereportserviceiface provides an interface to enable mocking the AWS Cost and Usage Report Service service client for testing your code. |
|
costexplorer
Package costexplorer provides the client and types for making API requests to AWS Cost Explorer Service.
|
Package costexplorer provides the client and types for making API requests to AWS Cost Explorer Service. |
|
costexplorer/costexploreriface
Package costexploreriface provides an interface to enable mocking the AWS Cost Explorer Service service client for testing your code.
|
Package costexploreriface provides an interface to enable mocking the AWS Cost Explorer Service service client for testing your code. |
|
databasemigrationservice
Package databasemigrationservice provides the client and types for making API requests to AWS Database Migration Service.
|
Package databasemigrationservice provides the client and types for making API requests to AWS Database Migration Service. |
|
databasemigrationservice/databasemigrationserviceiface
Package databasemigrationserviceiface provides an interface to enable mocking the AWS Database Migration Service service client for testing your code.
|
Package databasemigrationserviceiface provides an interface to enable mocking the AWS Database Migration Service service client for testing your code. |
|
datapipeline
Package datapipeline provides the client and types for making API requests to AWS Data Pipeline.
|
Package datapipeline provides the client and types for making API requests to AWS Data Pipeline. |
|
datapipeline/datapipelineiface
Package datapipelineiface provides an interface to enable mocking the AWS Data Pipeline service client for testing your code.
|
Package datapipelineiface provides an interface to enable mocking the AWS Data Pipeline service client for testing your code. |
|
dax
Package dax provides the client and types for making API requests to Amazon DynamoDB Accelerator (DAX).
|
Package dax provides the client and types for making API requests to Amazon DynamoDB Accelerator (DAX). |
|
dax/daxiface
Package daxiface provides an interface to enable mocking the Amazon DynamoDB Accelerator (DAX) service client for testing your code.
|
Package daxiface provides an interface to enable mocking the Amazon DynamoDB Accelerator (DAX) service client for testing your code. |
|
devicefarm
Package devicefarm provides the client and types for making API requests to AWS Device Farm.
|
Package devicefarm provides the client and types for making API requests to AWS Device Farm. |
|
devicefarm/devicefarmiface
Package devicefarmiface provides an interface to enable mocking the AWS Device Farm service client for testing your code.
|
Package devicefarmiface provides an interface to enable mocking the AWS Device Farm service client for testing your code. |
|
directconnect
Package directconnect provides the client and types for making API requests to AWS Direct Connect.
|
Package directconnect provides the client and types for making API requests to AWS Direct Connect. |
|
directconnect/directconnectiface
Package directconnectiface provides an interface to enable mocking the AWS Direct Connect service client for testing your code.
|
Package directconnectiface provides an interface to enable mocking the AWS Direct Connect service client for testing your code. |
|
directoryservice
Package directoryservice provides the client and types for making API requests to AWS Directory Service.
|
Package directoryservice provides the client and types for making API requests to AWS Directory Service. |
|
directoryservice/directoryserviceiface
Package directoryserviceiface provides an interface to enable mocking the AWS Directory Service service client for testing your code.
|
Package directoryserviceiface provides an interface to enable mocking the AWS Directory Service service client for testing your code. |
|
dynamodb
Package dynamodb provides the client and types for making API requests to Amazon DynamoDB.
|
Package dynamodb provides the client and types for making API requests to Amazon DynamoDB. |
|
dynamodb/dynamodbattribute
Package dynamodbattribute provides marshaling and unmarshaling utilities to convert between Go types and dynamodb.AttributeValues.
|
Package dynamodbattribute provides marshaling and unmarshaling utilities to convert between Go types and dynamodb.AttributeValues. |
|
dynamodb/dynamodbiface
Package dynamodbiface provides an interface to enable mocking the Amazon DynamoDB service client for testing your code.
|
Package dynamodbiface provides an interface to enable mocking the Amazon DynamoDB service client for testing your code. |
|
dynamodb/expression
Package expression provides types and functions to create Amazon DynamoDB Expression strings, ExpressionAttributeNames maps, and ExpressionAttributeValues maps.
|
Package expression provides types and functions to create Amazon DynamoDB Expression strings, ExpressionAttributeNames maps, and ExpressionAttributeValues maps. |
|
dynamodbstreams
Package dynamodbstreams provides the client and types for making API requests to Amazon DynamoDB Streams.
|
Package dynamodbstreams provides the client and types for making API requests to Amazon DynamoDB Streams. |
|
dynamodbstreams/dynamodbstreamsiface
Package dynamodbstreamsiface provides an interface to enable mocking the Amazon DynamoDB Streams service client for testing your code.
|
Package dynamodbstreamsiface provides an interface to enable mocking the Amazon DynamoDB Streams service client for testing your code. |
|
ec2
Package ec2 provides the client and types for making API requests to Amazon Elastic Compute Cloud.
|
Package ec2 provides the client and types for making API requests to Amazon Elastic Compute Cloud. |
|
ec2/ec2iface
Package ec2iface provides an interface to enable mocking the Amazon Elastic Compute Cloud service client for testing your code.
|
Package ec2iface provides an interface to enable mocking the Amazon Elastic Compute Cloud service client for testing your code. |
|
ecr
Package ecr provides the client and types for making API requests to Amazon EC2 Container Registry.
|
Package ecr provides the client and types for making API requests to Amazon EC2 Container Registry. |
|
ecr/ecriface
Package ecriface provides an interface to enable mocking the Amazon EC2 Container Registry service client for testing your code.
|
Package ecriface provides an interface to enable mocking the Amazon EC2 Container Registry service client for testing your code. |
|
ecs
Package ecs provides the client and types for making API requests to Amazon EC2 Container Service.
|
Package ecs provides the client and types for making API requests to Amazon EC2 Container Service. |
|
ecs/ecsiface
Package ecsiface provides an interface to enable mocking the Amazon EC2 Container Service service client for testing your code.
|
Package ecsiface provides an interface to enable mocking the Amazon EC2 Container Service service client for testing your code. |
|
efs
Package efs provides the client and types for making API requests to Amazon Elastic File System.
|
Package efs provides the client and types for making API requests to Amazon Elastic File System. |
|
efs/efsiface
Package efsiface provides an interface to enable mocking the Amazon Elastic File System service client for testing your code.
|
Package efsiface provides an interface to enable mocking the Amazon Elastic File System service client for testing your code. |
|
elasticache
Package elasticache provides the client and types for making API requests to Amazon ElastiCache.
|
Package elasticache provides the client and types for making API requests to Amazon ElastiCache. |
|
elasticache/elasticacheiface
Package elasticacheiface provides an interface to enable mocking the Amazon ElastiCache service client for testing your code.
|
Package elasticacheiface provides an interface to enable mocking the Amazon ElastiCache service client for testing your code. |
|
elasticbeanstalk
Package elasticbeanstalk provides the client and types for making API requests to AWS Elastic Beanstalk.
|
Package elasticbeanstalk provides the client and types for making API requests to AWS Elastic Beanstalk. |
|
elasticbeanstalk/elasticbeanstalkiface
Package elasticbeanstalkiface provides an interface to enable mocking the AWS Elastic Beanstalk service client for testing your code.
|
Package elasticbeanstalkiface provides an interface to enable mocking the AWS Elastic Beanstalk service client for testing your code. |
|
elasticsearchservice
Package elasticsearchservice provides the client and types for making API requests to Amazon Elasticsearch Service.
|
Package elasticsearchservice provides the client and types for making API requests to Amazon Elasticsearch Service. |
|
elasticsearchservice/elasticsearchserviceiface
Package elasticsearchserviceiface provides an interface to enable mocking the Amazon Elasticsearch Service service client for testing your code.
|
Package elasticsearchserviceiface provides an interface to enable mocking the Amazon Elasticsearch Service service client for testing your code. |
|
elastictranscoder
Package elastictranscoder provides the client and types for making API requests to Amazon Elastic Transcoder.
|
Package elastictranscoder provides the client and types for making API requests to Amazon Elastic Transcoder. |
|
elastictranscoder/elastictranscoderiface
Package elastictranscoderiface provides an interface to enable mocking the Amazon Elastic Transcoder service client for testing your code.
|
Package elastictranscoderiface provides an interface to enable mocking the Amazon Elastic Transcoder service client for testing your code. |
|
elb
Package elb provides the client and types for making API requests to Elastic Load Balancing.
|
Package elb provides the client and types for making API requests to Elastic Load Balancing. |
|
elb/elbiface
Package elbiface provides an interface to enable mocking the Elastic Load Balancing service client for testing your code.
|
Package elbiface provides an interface to enable mocking the Elastic Load Balancing service client for testing your code. |
|
elbv2
Package elbv2 provides the client and types for making API requests to Elastic Load Balancing.
|
Package elbv2 provides the client and types for making API requests to Elastic Load Balancing. |
|
elbv2/elbv2iface
Package elbv2iface provides an interface to enable mocking the Elastic Load Balancing service client for testing your code.
|
Package elbv2iface provides an interface to enable mocking the Elastic Load Balancing service client for testing your code. |
|
emr
Package emr provides the client and types for making API requests to Amazon Elastic MapReduce.
|
Package emr provides the client and types for making API requests to Amazon Elastic MapReduce. |
|
emr/emriface
Package emriface provides an interface to enable mocking the Amazon Elastic MapReduce service client for testing your code.
|
Package emriface provides an interface to enable mocking the Amazon Elastic MapReduce service client for testing your code. |
|
firehose
Package firehose provides the client and types for making API requests to Amazon Kinesis Firehose.
|
Package firehose provides the client and types for making API requests to Amazon Kinesis Firehose. |
|
firehose/firehoseiface
Package firehoseiface provides an interface to enable mocking the Amazon Kinesis Firehose service client for testing your code.
|
Package firehoseiface provides an interface to enable mocking the Amazon Kinesis Firehose service client for testing your code. |
|
fms
Package fms provides the client and types for making API requests to Firewall Management Service.
|
Package fms provides the client and types for making API requests to Firewall Management Service. |
|
fms/fmsiface
Package fmsiface provides an interface to enable mocking the Firewall Management Service service client for testing your code.
|
Package fmsiface provides an interface to enable mocking the Firewall Management Service service client for testing your code. |
|
gamelift
Package gamelift provides the client and types for making API requests to Amazon GameLift.
|
Package gamelift provides the client and types for making API requests to Amazon GameLift. |
|
gamelift/gameliftiface
Package gameliftiface provides an interface to enable mocking the Amazon GameLift service client for testing your code.
|
Package gameliftiface provides an interface to enable mocking the Amazon GameLift service client for testing your code. |
|
glacier
Package glacier provides the client and types for making API requests to Amazon Glacier.
|
Package glacier provides the client and types for making API requests to Amazon Glacier. |
|
glacier/glacieriface
Package glacieriface provides an interface to enable mocking the Amazon Glacier service client for testing your code.
|
Package glacieriface provides an interface to enable mocking the Amazon Glacier service client for testing your code. |
|
glue
Package glue provides the client and types for making API requests to AWS Glue.
|
Package glue provides the client and types for making API requests to AWS Glue. |
|
glue/glueiface
Package glueiface provides an interface to enable mocking the AWS Glue service client for testing your code.
|
Package glueiface provides an interface to enable mocking the AWS Glue service client for testing your code. |
|
greengrass
Package greengrass provides the client and types for making API requests to AWS Greengrass.
|
Package greengrass provides the client and types for making API requests to AWS Greengrass. |
|
greengrass/greengrassiface
Package greengrassiface provides an interface to enable mocking the AWS Greengrass service client for testing your code.
|
Package greengrassiface provides an interface to enable mocking the AWS Greengrass service client for testing your code. |
|
guardduty
Package guardduty provides the client and types for making API requests to Amazon GuardDuty.
|
Package guardduty provides the client and types for making API requests to Amazon GuardDuty. |
|
guardduty/guarddutyiface
Package guarddutyiface provides an interface to enable mocking the Amazon GuardDuty service client for testing your code.
|
Package guarddutyiface provides an interface to enable mocking the Amazon GuardDuty service client for testing your code. |
|
health
Package health provides the client and types for making API requests to AWS Health APIs and Notifications.
|
Package health provides the client and types for making API requests to AWS Health APIs and Notifications. |
|
health/healthiface
Package healthiface provides an interface to enable mocking the AWS Health APIs and Notifications service client for testing your code.
|
Package healthiface provides an interface to enable mocking the AWS Health APIs and Notifications service client for testing your code. |
|
iam
Package iam provides the client and types for making API requests to AWS Identity and Access Management.
|
Package iam provides the client and types for making API requests to AWS Identity and Access Management. |
|
iam/iamiface
Package iamiface provides an interface to enable mocking the AWS Identity and Access Management service client for testing your code.
|
Package iamiface provides an interface to enable mocking the AWS Identity and Access Management service client for testing your code. |
|
inspector
Package inspector provides the client and types for making API requests to Amazon Inspector.
|
Package inspector provides the client and types for making API requests to Amazon Inspector. |
|
inspector/inspectoriface
Package inspectoriface provides an interface to enable mocking the Amazon Inspector service client for testing your code.
|
Package inspectoriface provides an interface to enable mocking the Amazon Inspector service client for testing your code. |
|
iot
Package iot provides the client and types for making API requests to AWS IoT. AWS IoT provides secure, bi-directional communication between Internet-connected devices (such as sensors, actuators, embedded devices, or smart appliances) and the AWS cloud.
|
Package iot provides the client and types for making API requests to AWS IoT. AWS IoT provides secure, bi-directional communication between Internet-connected devices (such as sensors, actuators, embedded devices, or smart appliances) and the AWS cloud. |
|
iot/iotiface
Package iotiface provides an interface to enable mocking the AWS IoT service client for testing your code.
|
Package iotiface provides an interface to enable mocking the AWS IoT service client for testing your code. |
|
iot1clickdevicesservice
Package iot1clickdevicesservice provides the client and types for making API requests to AWS IoT 1-Click Devices Service.
|
Package iot1clickdevicesservice provides the client and types for making API requests to AWS IoT 1-Click Devices Service. |
|
iot1clickdevicesservice/iot1clickdevicesserviceiface
Package iot1clickdevicesserviceiface provides an interface to enable mocking the AWS IoT 1-Click Devices Service service client for testing your code.
|
Package iot1clickdevicesserviceiface provides an interface to enable mocking the AWS IoT 1-Click Devices Service service client for testing your code. |
|
iot1clickprojects
Package iot1clickprojects provides the client and types for making API requests to AWS IoT 1-Click Projects Service.
|
Package iot1clickprojects provides the client and types for making API requests to AWS IoT 1-Click Projects Service. |
|
iot1clickprojects/iot1clickprojectsiface
Package iot1clickprojectsiface provides an interface to enable mocking the AWS IoT 1-Click Projects Service service client for testing your code.
|
Package iot1clickprojectsiface provides an interface to enable mocking the AWS IoT 1-Click Projects Service service client for testing your code. |
|
iotanalytics
Package iotanalytics provides the client and types for making API requests to AWS IoT Analytics.
|
Package iotanalytics provides the client and types for making API requests to AWS IoT Analytics. |
|
iotanalytics/iotanalyticsiface
Package iotanalyticsiface provides an interface to enable mocking the AWS IoT Analytics service client for testing your code.
|
Package iotanalyticsiface provides an interface to enable mocking the AWS IoT Analytics service client for testing your code. |
|
iotdataplane
Package iotdataplane provides the client and types for making API requests to AWS IoT Data Plane.
|
Package iotdataplane provides the client and types for making API requests to AWS IoT Data Plane. |
|
iotdataplane/iotdataplaneiface
Package iotdataplaneiface provides an interface to enable mocking the AWS IoT Data Plane service client for testing your code.
|
Package iotdataplaneiface provides an interface to enable mocking the AWS IoT Data Plane service client for testing your code. |
|
iotjobsdataplane
Package iotjobsdataplane provides the client and types for making API requests to AWS IoT Jobs Data Plane.
|
Package iotjobsdataplane provides the client and types for making API requests to AWS IoT Jobs Data Plane. |
|
iotjobsdataplane/iotjobsdataplaneiface
Package iotjobsdataplaneiface provides an interface to enable mocking the AWS IoT Jobs Data Plane service client for testing your code.
|
Package iotjobsdataplaneiface provides an interface to enable mocking the AWS IoT Jobs Data Plane service client for testing your code. |
|
kinesis
Package kinesis provides the client and types for making API requests to Amazon Kinesis.
|
Package kinesis provides the client and types for making API requests to Amazon Kinesis. |
|
kinesis/kinesisiface
Package kinesisiface provides an interface to enable mocking the Amazon Kinesis service client for testing your code.
|
Package kinesisiface provides an interface to enable mocking the Amazon Kinesis service client for testing your code. |
|
kinesisanalytics
Package kinesisanalytics provides the client and types for making API requests to Amazon Kinesis Analytics.
|
Package kinesisanalytics provides the client and types for making API requests to Amazon Kinesis Analytics. |
|
kinesisanalytics/kinesisanalyticsiface
Package kinesisanalyticsiface provides an interface to enable mocking the Amazon Kinesis Analytics service client for testing your code.
|
Package kinesisanalyticsiface provides an interface to enable mocking the Amazon Kinesis Analytics service client for testing your code. |
|
kinesisvideo
Package kinesisvideo provides the client and types for making API requests to Amazon Kinesis Video Streams.
|
Package kinesisvideo provides the client and types for making API requests to Amazon Kinesis Video Streams. |
|
kinesisvideo/kinesisvideoiface
Package kinesisvideoiface provides an interface to enable mocking the Amazon Kinesis Video Streams service client for testing your code.
|
Package kinesisvideoiface provides an interface to enable mocking the Amazon Kinesis Video Streams service client for testing your code. |
|
kinesisvideoarchivedmedia
Package kinesisvideoarchivedmedia provides the client and types for making API requests to Amazon Kinesis Video Streams Archived Media.
|
Package kinesisvideoarchivedmedia provides the client and types for making API requests to Amazon Kinesis Video Streams Archived Media. |
|
kinesisvideoarchivedmedia/kinesisvideoarchivedmediaiface
Package kinesisvideoarchivedmediaiface provides an interface to enable mocking the Amazon Kinesis Video Streams Archived Media service client for testing your code.
|
Package kinesisvideoarchivedmediaiface provides an interface to enable mocking the Amazon Kinesis Video Streams Archived Media service client for testing your code. |
|
kinesisvideomedia
Package kinesisvideomedia provides the client and types for making API requests to Amazon Kinesis Video Streams Media.
|
Package kinesisvideomedia provides the client and types for making API requests to Amazon Kinesis Video Streams Media. |
|
kinesisvideomedia/kinesisvideomediaiface
Package kinesisvideomediaiface provides an interface to enable mocking the Amazon Kinesis Video Streams Media service client for testing your code.
|
Package kinesisvideomediaiface provides an interface to enable mocking the Amazon Kinesis Video Streams Media service client for testing your code. |
|
kms
Package kms provides the client and types for making API requests to AWS Key Management Service.
|
Package kms provides the client and types for making API requests to AWS Key Management Service. |
|
kms/kmsiface
Package kmsiface provides an interface to enable mocking the AWS Key Management Service service client for testing your code.
|
Package kmsiface provides an interface to enable mocking the AWS Key Management Service service client for testing your code. |
|
lambda
Package lambda provides the client and types for making API requests to AWS Lambda.
|
Package lambda provides the client and types for making API requests to AWS Lambda. |
|
lambda/lambdaiface
Package lambdaiface provides an interface to enable mocking the AWS Lambda service client for testing your code.
|
Package lambdaiface provides an interface to enable mocking the AWS Lambda service client for testing your code. |
|
lexmodelbuildingservice
Package lexmodelbuildingservice provides the client and types for making API requests to Amazon Lex Model Building Service.
|
Package lexmodelbuildingservice provides the client and types for making API requests to Amazon Lex Model Building Service. |
|
lexmodelbuildingservice/lexmodelbuildingserviceiface
Package lexmodelbuildingserviceiface provides an interface to enable mocking the Amazon Lex Model Building Service service client for testing your code.
|
Package lexmodelbuildingserviceiface provides an interface to enable mocking the Amazon Lex Model Building Service service client for testing your code. |
|
lexruntimeservice
Package lexruntimeservice provides the client and types for making API requests to Amazon Lex Runtime Service.
|
Package lexruntimeservice provides the client and types for making API requests to Amazon Lex Runtime Service. |
|
lexruntimeservice/lexruntimeserviceiface
Package lexruntimeserviceiface provides an interface to enable mocking the Amazon Lex Runtime Service service client for testing your code.
|
Package lexruntimeserviceiface provides an interface to enable mocking the Amazon Lex Runtime Service service client for testing your code. |
|
lightsail
Package lightsail provides the client and types for making API requests to Amazon Lightsail.
|
Package lightsail provides the client and types for making API requests to Amazon Lightsail. |
|
lightsail/lightsailiface
Package lightsailiface provides an interface to enable mocking the Amazon Lightsail service client for testing your code.
|
Package lightsailiface provides an interface to enable mocking the Amazon Lightsail service client for testing your code. |
|
machinelearning
Package machinelearning provides the client and types for making API requests to Amazon Machine Learning.
|
Package machinelearning provides the client and types for making API requests to Amazon Machine Learning. |
|
machinelearning/machinelearningiface
Package machinelearningiface provides an interface to enable mocking the Amazon Machine Learning service client for testing your code.
|
Package machinelearningiface provides an interface to enable mocking the Amazon Machine Learning service client for testing your code. |
|
marketplacecommerceanalytics
Package marketplacecommerceanalytics provides the client and types for making API requests to AWS Marketplace Commerce Analytics.
|
Package marketplacecommerceanalytics provides the client and types for making API requests to AWS Marketplace Commerce Analytics. |
|
marketplacecommerceanalytics/marketplacecommerceanalyticsiface
Package marketplacecommerceanalyticsiface provides an interface to enable mocking the AWS Marketplace Commerce Analytics service client for testing your code.
|
Package marketplacecommerceanalyticsiface provides an interface to enable mocking the AWS Marketplace Commerce Analytics service client for testing your code. |
|
marketplaceentitlementservice
Package marketplaceentitlementservice provides the client and types for making API requests to AWS Marketplace Entitlement Service.
|
Package marketplaceentitlementservice provides the client and types for making API requests to AWS Marketplace Entitlement Service. |
|
marketplaceentitlementservice/marketplaceentitlementserviceiface
Package marketplaceentitlementserviceiface provides an interface to enable mocking the AWS Marketplace Entitlement Service service client for testing your code.
|
Package marketplaceentitlementserviceiface provides an interface to enable mocking the AWS Marketplace Entitlement Service service client for testing your code. |
|
marketplacemetering
Package marketplacemetering provides the client and types for making API requests to AWSMarketplace Metering.
|
Package marketplacemetering provides the client and types for making API requests to AWSMarketplace Metering. |
|
marketplacemetering/marketplacemeteringiface
Package marketplacemeteringiface provides an interface to enable mocking the AWSMarketplace Metering service client for testing your code.
|
Package marketplacemeteringiface provides an interface to enable mocking the AWSMarketplace Metering service client for testing your code. |
|
mediaconvert
Package mediaconvert provides the client and types for making API requests to AWS Elemental MediaConvert.
|
Package mediaconvert provides the client and types for making API requests to AWS Elemental MediaConvert. |
|
mediaconvert/mediaconvertiface
Package mediaconvertiface provides an interface to enable mocking the AWS Elemental MediaConvert service client for testing your code.
|
Package mediaconvertiface provides an interface to enable mocking the AWS Elemental MediaConvert service client for testing your code. |
|
medialive
Package medialive provides the client and types for making API requests to AWS Elemental MediaLive.
|
Package medialive provides the client and types for making API requests to AWS Elemental MediaLive. |
|
medialive/medialiveiface
Package medialiveiface provides an interface to enable mocking the AWS Elemental MediaLive service client for testing your code.
|
Package medialiveiface provides an interface to enable mocking the AWS Elemental MediaLive service client for testing your code. |
|
mediapackage
Package mediapackage provides the client and types for making API requests to AWS Elemental MediaPackage.
|
Package mediapackage provides the client and types for making API requests to AWS Elemental MediaPackage. |
|
mediapackage/mediapackageiface
Package mediapackageiface provides an interface to enable mocking the AWS Elemental MediaPackage service client for testing your code.
|
Package mediapackageiface provides an interface to enable mocking the AWS Elemental MediaPackage service client for testing your code. |
|
mediastore
Package mediastore provides the client and types for making API requests to AWS Elemental MediaStore.
|
Package mediastore provides the client and types for making API requests to AWS Elemental MediaStore. |
|
mediastore/mediastoreiface
Package mediastoreiface provides an interface to enable mocking the AWS Elemental MediaStore service client for testing your code.
|
Package mediastoreiface provides an interface to enable mocking the AWS Elemental MediaStore service client for testing your code. |
|
mediastoredata
Package mediastoredata provides the client and types for making API requests to AWS Elemental MediaStore Data Plane.
|
Package mediastoredata provides the client and types for making API requests to AWS Elemental MediaStore Data Plane. |
|
mediastoredata/mediastoredataiface
Package mediastoredataiface provides an interface to enable mocking the AWS Elemental MediaStore Data Plane service client for testing your code.
|
Package mediastoredataiface provides an interface to enable mocking the AWS Elemental MediaStore Data Plane service client for testing your code. |
|
migrationhub
Package migrationhub provides the client and types for making API requests to AWS Migration Hub.
|
Package migrationhub provides the client and types for making API requests to AWS Migration Hub. |
|
migrationhub/migrationhubiface
Package migrationhubiface provides an interface to enable mocking the AWS Migration Hub service client for testing your code.
|
Package migrationhubiface provides an interface to enable mocking the AWS Migration Hub service client for testing your code. |
|
mobile
Package mobile provides the client and types for making API requests to AWS Mobile.
|
Package mobile provides the client and types for making API requests to AWS Mobile. |
|
mobile/mobileiface
Package mobileiface provides an interface to enable mocking the AWS Mobile service client for testing your code.
|
Package mobileiface provides an interface to enable mocking the AWS Mobile service client for testing your code. |
|
mobileanalytics
Package mobileanalytics provides the client and types for making API requests to Amazon Mobile Analytics.
|
Package mobileanalytics provides the client and types for making API requests to Amazon Mobile Analytics. |
|
mobileanalytics/mobileanalyticsiface
Package mobileanalyticsiface provides an interface to enable mocking the Amazon Mobile Analytics service client for testing your code.
|
Package mobileanalyticsiface provides an interface to enable mocking the Amazon Mobile Analytics service client for testing your code. |
|
mq
Package mq provides the client and types for making API requests to AmazonMQ.
|
Package mq provides the client and types for making API requests to AmazonMQ. |
|
mq/mqiface
Package mqiface provides an interface to enable mocking the AmazonMQ service client for testing your code.
|
Package mqiface provides an interface to enable mocking the AmazonMQ service client for testing your code. |
|
mturk
Package mturk provides the client and types for making API requests to Amazon Mechanical Turk.
|
Package mturk provides the client and types for making API requests to Amazon Mechanical Turk. |
|
mturk/mturkiface
Package mturkiface provides an interface to enable mocking the Amazon Mechanical Turk service client for testing your code.
|
Package mturkiface provides an interface to enable mocking the Amazon Mechanical Turk service client for testing your code. |
|
opsworks
Package opsworks provides the client and types for making API requests to AWS OpsWorks.
|
Package opsworks provides the client and types for making API requests to AWS OpsWorks. |
|
opsworks/opsworksiface
Package opsworksiface provides an interface to enable mocking the AWS OpsWorks service client for testing your code.
|
Package opsworksiface provides an interface to enable mocking the AWS OpsWorks service client for testing your code. |
|
opsworkscm
Package opsworkscm provides the client and types for making API requests to AWS OpsWorks for Chef Automate.
|
Package opsworkscm provides the client and types for making API requests to AWS OpsWorks for Chef Automate. |
|
opsworkscm/opsworkscmiface
Package opsworkscmiface provides an interface to enable mocking the AWS OpsWorks for Chef Automate service client for testing your code.
|
Package opsworkscmiface provides an interface to enable mocking the AWS OpsWorks for Chef Automate service client for testing your code. |
|
organizations
Package organizations provides the client and types for making API requests to AWS Organizations.
|
Package organizations provides the client and types for making API requests to AWS Organizations. |
|
organizations/organizationsiface
Package organizationsiface provides an interface to enable mocking the AWS Organizations service client for testing your code.
|
Package organizationsiface provides an interface to enable mocking the AWS Organizations service client for testing your code. |
|
pinpoint
Package pinpoint provides the client and types for making API requests to Amazon Pinpoint.
|
Package pinpoint provides the client and types for making API requests to Amazon Pinpoint. |
|
pinpoint/pinpointiface
Package pinpointiface provides an interface to enable mocking the Amazon Pinpoint service client for testing your code.
|
Package pinpointiface provides an interface to enable mocking the Amazon Pinpoint service client for testing your code. |
|
polly
Package polly provides the client and types for making API requests to Amazon Polly.
|
Package polly provides the client and types for making API requests to Amazon Polly. |
|
polly/pollyiface
Package pollyiface provides an interface to enable mocking the Amazon Polly service client for testing your code.
|
Package pollyiface provides an interface to enable mocking the Amazon Polly service client for testing your code. |
|
pricing
Package pricing provides the client and types for making API requests to AWS Price List Service.
|
Package pricing provides the client and types for making API requests to AWS Price List Service. |
|
pricing/pricingiface
Package pricingiface provides an interface to enable mocking the AWS Price List Service service client for testing your code.
|
Package pricingiface provides an interface to enable mocking the AWS Price List Service service client for testing your code. |
|
rds
Package rds provides the client and types for making API requests to Amazon Relational Database Service.
|
Package rds provides the client and types for making API requests to Amazon Relational Database Service. |
|
rds/rdsiface
Package rdsiface provides an interface to enable mocking the Amazon Relational Database Service service client for testing your code.
|
Package rdsiface provides an interface to enable mocking the Amazon Relational Database Service service client for testing your code. |
|
redshift
Package redshift provides the client and types for making API requests to Amazon Redshift.
|
Package redshift provides the client and types for making API requests to Amazon Redshift. |
|
redshift/redshiftiface
Package redshiftiface provides an interface to enable mocking the Amazon Redshift service client for testing your code.
|
Package redshiftiface provides an interface to enable mocking the Amazon Redshift service client for testing your code. |
|
rekognition
Package rekognition provides the client and types for making API requests to Amazon Rekognition.
|
Package rekognition provides the client and types for making API requests to Amazon Rekognition. |
|
rekognition/rekognitioniface
Package rekognitioniface provides an interface to enable mocking the Amazon Rekognition service client for testing your code.
|
Package rekognitioniface provides an interface to enable mocking the Amazon Rekognition service client for testing your code. |
|
resourcegroups
Package resourcegroups provides the client and types for making API requests to AWS Resource Groups.
|
Package resourcegroups provides the client and types for making API requests to AWS Resource Groups. |
|
resourcegroups/resourcegroupsiface
Package resourcegroupsiface provides an interface to enable mocking the AWS Resource Groups service client for testing your code.
|
Package resourcegroupsiface provides an interface to enable mocking the AWS Resource Groups service client for testing your code. |
|
resourcegroupstaggingapi
Package resourcegroupstaggingapi provides the client and types for making API requests to AWS Resource Groups Tagging API.
|
Package resourcegroupstaggingapi provides the client and types for making API requests to AWS Resource Groups Tagging API. |
|
resourcegroupstaggingapi/resourcegroupstaggingapiiface
Package resourcegroupstaggingapiiface provides an interface to enable mocking the AWS Resource Groups Tagging API service client for testing your code.
|
Package resourcegroupstaggingapiiface provides an interface to enable mocking the AWS Resource Groups Tagging API service client for testing your code. |
|
route53
Package route53 provides the client and types for making API requests to Amazon Route 53.
|
Package route53 provides the client and types for making API requests to Amazon Route 53. |
|
route53/route53iface
Package route53iface provides an interface to enable mocking the Amazon Route 53 service client for testing your code.
|
Package route53iface provides an interface to enable mocking the Amazon Route 53 service client for testing your code. |
|
route53domains
Package route53domains provides the client and types for making API requests to Amazon Route 53 Domains.
|
Package route53domains provides the client and types for making API requests to Amazon Route 53 Domains. |
|
route53domains/route53domainsiface
Package route53domainsiface provides an interface to enable mocking the Amazon Route 53 Domains service client for testing your code.
|
Package route53domainsiface provides an interface to enable mocking the Amazon Route 53 Domains service client for testing your code. |
|
s3
Package s3 provides the client and types for making API requests to Amazon Simple Storage Service.
|
Package s3 provides the client and types for making API requests to Amazon Simple Storage Service. |
|
s3/s3crypto
Package s3crypto provides encryption to S3 using KMS and AES GCM.
|
Package s3crypto provides encryption to S3 using KMS and AES GCM. |
|
s3/s3iface
Package s3iface provides an interface to enable mocking the Amazon Simple Storage Service service client for testing your code.
|
Package s3iface provides an interface to enable mocking the Amazon Simple Storage Service service client for testing your code. |
|
s3/s3manager
Package s3manager provides utilities to upload and download objects from S3 concurrently.
|
Package s3manager provides utilities to upload and download objects from S3 concurrently. |
|
s3/s3manager/s3manageriface
Package s3manageriface provides an interface for the s3manager package
|
Package s3manageriface provides an interface for the s3manager package |
|
sagemaker
Package sagemaker provides the client and types for making API requests to Amazon SageMaker Service.
|
Package sagemaker provides the client and types for making API requests to Amazon SageMaker Service. |
|
sagemaker/sagemakeriface
Package sagemakeriface provides an interface to enable mocking the Amazon SageMaker Service service client for testing your code.
|
Package sagemakeriface provides an interface to enable mocking the Amazon SageMaker Service service client for testing your code. |
|
sagemakerruntime
Package sagemakerruntime provides the client and types for making API requests to Amazon SageMaker Runtime.
|
Package sagemakerruntime provides the client and types for making API requests to Amazon SageMaker Runtime. |
|
sagemakerruntime/sagemakerruntimeiface
Package sagemakerruntimeiface provides an interface to enable mocking the Amazon SageMaker Runtime service client for testing your code.
|
Package sagemakerruntimeiface provides an interface to enable mocking the Amazon SageMaker Runtime service client for testing your code. |
|
secretsmanager
Package secretsmanager provides the client and types for making API requests to AWS Secrets Manager.
|
Package secretsmanager provides the client and types for making API requests to AWS Secrets Manager. |
|
secretsmanager/secretsmanageriface
Package secretsmanageriface provides an interface to enable mocking the AWS Secrets Manager service client for testing your code.
|
Package secretsmanageriface provides an interface to enable mocking the AWS Secrets Manager service client for testing your code. |
|
serverlessapplicationrepository
Package serverlessapplicationrepository provides the client and types for making API requests to AWSServerlessApplicationRepository.
|
Package serverlessapplicationrepository provides the client and types for making API requests to AWSServerlessApplicationRepository. |
|
serverlessapplicationrepository/serverlessapplicationrepositoryiface
Package serverlessapplicationrepositoryiface provides an interface to enable mocking the AWSServerlessApplicationRepository service client for testing your code.
|
Package serverlessapplicationrepositoryiface provides an interface to enable mocking the AWSServerlessApplicationRepository service client for testing your code. |
|
servicecatalog
Package servicecatalog provides the client and types for making API requests to AWS Service Catalog.
|
Package servicecatalog provides the client and types for making API requests to AWS Service Catalog. |
|
servicecatalog/servicecatalogiface
Package servicecatalogiface provides an interface to enable mocking the AWS Service Catalog service client for testing your code.
|
Package servicecatalogiface provides an interface to enable mocking the AWS Service Catalog service client for testing your code. |
|
servicediscovery
Package servicediscovery provides the client and types for making API requests to Amazon Route 53 Auto Naming.
|
Package servicediscovery provides the client and types for making API requests to Amazon Route 53 Auto Naming. |
|
servicediscovery/servicediscoveryiface
Package servicediscoveryiface provides an interface to enable mocking the Amazon Route 53 Auto Naming service client for testing your code.
|
Package servicediscoveryiface provides an interface to enable mocking the Amazon Route 53 Auto Naming service client for testing your code. |
|
ses
Package ses provides the client and types for making API requests to Amazon Simple Email Service.
|
Package ses provides the client and types for making API requests to Amazon Simple Email Service. |
|
ses/sesiface
Package sesiface provides an interface to enable mocking the Amazon Simple Email Service service client for testing your code.
|
Package sesiface provides an interface to enable mocking the Amazon Simple Email Service service client for testing your code. |
|
sfn
Package sfn provides the client and types for making API requests to AWS Step Functions.
|
Package sfn provides the client and types for making API requests to AWS Step Functions. |
|
sfn/sfniface
Package sfniface provides an interface to enable mocking the AWS Step Functions service client for testing your code.
|
Package sfniface provides an interface to enable mocking the AWS Step Functions service client for testing your code. |
|
shield
Package shield provides the client and types for making API requests to AWS Shield.
|
Package shield provides the client and types for making API requests to AWS Shield. |
|
shield/shieldiface
Package shieldiface provides an interface to enable mocking the AWS Shield service client for testing your code.
|
Package shieldiface provides an interface to enable mocking the AWS Shield service client for testing your code. |
|
simpledb
Package simpledb provides the client and types for making API requests to Amazon SimpleDB.
|
Package simpledb provides the client and types for making API requests to Amazon SimpleDB. |
|
simpledb/simpledbiface
Package simpledbiface provides an interface to enable mocking the Amazon SimpleDB service client for testing your code.
|
Package simpledbiface provides an interface to enable mocking the Amazon SimpleDB service client for testing your code. |
|
sms
Package sms provides the client and types for making API requests to AWS Server Migration Service.
|
Package sms provides the client and types for making API requests to AWS Server Migration Service. |
|
sms/smsiface
Package smsiface provides an interface to enable mocking the AWS Server Migration Service service client for testing your code.
|
Package smsiface provides an interface to enable mocking the AWS Server Migration Service service client for testing your code. |
|
snowball
Package snowball provides the client and types for making API requests to Amazon Import/Export Snowball.
|
Package snowball provides the client and types for making API requests to Amazon Import/Export Snowball. |
|
snowball/snowballiface
Package snowballiface provides an interface to enable mocking the Amazon Import/Export Snowball service client for testing your code.
|
Package snowballiface provides an interface to enable mocking the Amazon Import/Export Snowball service client for testing your code. |
|
sns
Package sns provides the client and types for making API requests to Amazon Simple Notification Service.
|
Package sns provides the client and types for making API requests to Amazon Simple Notification Service. |
|
sns/snsiface
Package snsiface provides an interface to enable mocking the Amazon Simple Notification Service service client for testing your code.
|
Package snsiface provides an interface to enable mocking the Amazon Simple Notification Service service client for testing your code. |
|
sqs
Package sqs provides the client and types for making API requests to Amazon Simple Queue Service.
|
Package sqs provides the client and types for making API requests to Amazon Simple Queue Service. |
|
sqs/sqsiface
Package sqsiface provides an interface to enable mocking the Amazon Simple Queue Service service client for testing your code.
|
Package sqsiface provides an interface to enable mocking the Amazon Simple Queue Service service client for testing your code. |
|
ssm
Package ssm provides the client and types for making API requests to Amazon Simple Systems Manager (SSM).
|
Package ssm provides the client and types for making API requests to Amazon Simple Systems Manager (SSM). |
|
ssm/ssmiface
Package ssmiface provides an interface to enable mocking the Amazon Simple Systems Manager (SSM) service client for testing your code.
|
Package ssmiface provides an interface to enable mocking the Amazon Simple Systems Manager (SSM) service client for testing your code. |
|
storagegateway
Package storagegateway provides the client and types for making API requests to AWS Storage Gateway.
|
Package storagegateway provides the client and types for making API requests to AWS Storage Gateway. |
|
storagegateway/storagegatewayiface
Package storagegatewayiface provides an interface to enable mocking the AWS Storage Gateway service client for testing your code.
|
Package storagegatewayiface provides an interface to enable mocking the AWS Storage Gateway service client for testing your code. |
|
sts
Package sts provides the client and types for making API requests to AWS Security Token Service.
|
Package sts provides the client and types for making API requests to AWS Security Token Service. |
|
sts/stsiface
Package stsiface provides an interface to enable mocking the AWS Security Token Service service client for testing your code.
|
Package stsiface provides an interface to enable mocking the AWS Security Token Service service client for testing your code. |
|
support
Package support provides the client and types for making API requests to AWS Support.
|
Package support provides the client and types for making API requests to AWS Support. |
|
support/supportiface
Package supportiface provides an interface to enable mocking the AWS Support service client for testing your code.
|
Package supportiface provides an interface to enable mocking the AWS Support service client for testing your code. |
|
swf
Package swf provides the client and types for making API requests to Amazon Simple Workflow Service.
|
Package swf provides the client and types for making API requests to Amazon Simple Workflow Service. |
|
swf/swfiface
Package swfiface provides an interface to enable mocking the Amazon Simple Workflow Service service client for testing your code.
|
Package swfiface provides an interface to enable mocking the Amazon Simple Workflow Service service client for testing your code. |
|
transcribeservice
Package transcribeservice provides the client and types for making API requests to Amazon Transcribe Service.
|
Package transcribeservice provides the client and types for making API requests to Amazon Transcribe Service. |
|
transcribeservice/transcribeserviceiface
Package transcribeserviceiface provides an interface to enable mocking the Amazon Transcribe Service service client for testing your code.
|
Package transcribeserviceiface provides an interface to enable mocking the Amazon Transcribe Service service client for testing your code. |
|
translate
Package translate provides the client and types for making API requests to Amazon Translate.
|
Package translate provides the client and types for making API requests to Amazon Translate. |
|
translate/translateiface
Package translateiface provides an interface to enable mocking the Amazon Translate service client for testing your code.
|
Package translateiface provides an interface to enable mocking the Amazon Translate service client for testing your code. |
|
waf
Package waf provides the client and types for making API requests to AWS WAF.
|
Package waf provides the client and types for making API requests to AWS WAF. |
|
waf/wafiface
Package wafiface provides an interface to enable mocking the AWS WAF service client for testing your code.
|
Package wafiface provides an interface to enable mocking the AWS WAF service client for testing your code. |
|
wafregional
Package wafregional provides the client and types for making API requests to AWS WAF Regional.
|
Package wafregional provides the client and types for making API requests to AWS WAF Regional. |
|
wafregional/wafregionaliface
Package wafregionaliface provides an interface to enable mocking the AWS WAF Regional service client for testing your code.
|
Package wafregionaliface provides an interface to enable mocking the AWS WAF Regional service client for testing your code. |
|
workdocs
Package workdocs provides the client and types for making API requests to Amazon WorkDocs.
|
Package workdocs provides the client and types for making API requests to Amazon WorkDocs. |
|
workdocs/workdocsiface
Package workdocsiface provides an interface to enable mocking the Amazon WorkDocs service client for testing your code.
|
Package workdocsiface provides an interface to enable mocking the Amazon WorkDocs service client for testing your code. |
|
workmail
Package workmail provides the client and types for making API requests to Amazon WorkMail.
|
Package workmail provides the client and types for making API requests to Amazon WorkMail. |
|
workmail/workmailiface
Package workmailiface provides an interface to enable mocking the Amazon WorkMail service client for testing your code.
|
Package workmailiface provides an interface to enable mocking the Amazon WorkMail service client for testing your code. |
|
workspaces
Package workspaces provides the client and types for making API requests to Amazon WorkSpaces.
|
Package workspaces provides the client and types for making API requests to Amazon WorkSpaces. |
|
workspaces/workspacesiface
Package workspacesiface provides an interface to enable mocking the Amazon WorkSpaces service client for testing your code.
|
Package workspacesiface provides an interface to enable mocking the Amazon WorkSpaces service client for testing your code. |
|
xray
Package xray provides the client and types for making API requests to AWS X-Ray.
|
Package xray provides the client and types for making API requests to AWS X-Ray. |
|
xray/xrayiface
Package xrayiface provides an interface to enable mocking the AWS X-Ray service client for testing your code.
|
Package xrayiface provides an interface to enable mocking the AWS X-Ray service client for testing your code. |
Click to show internal directories.
Click to hide internal directories.