Documentation

Overview

    Package service contains automatically generated AWS clients.

    Source Files

    Directories

    Path Synopsis
    acm
    Package acm provides the client and types for making API requests to AWS Certificate Manager.
    Package acm provides the client and types for making API requests to AWS Certificate Manager.
    acmiface
    Package acmiface provides an interface to enable mocking the AWS Certificate Manager service client for testing your code.
    Package acmiface provides an interface to enable mocking the AWS Certificate Manager service client for testing your code.
    Package apigateway provides the client and types for making API requests to Amazon API Gateway.
    Package apigateway provides the client and types for making API requests to Amazon API Gateway.
    apigatewayiface
    Package apigatewayiface provides an interface to enable mocking the Amazon API Gateway service client for testing your code.
    Package apigatewayiface provides an interface to enable mocking the Amazon API Gateway service client for testing your code.
    Package applicationautoscaling provides the client and types for making API requests to Application Auto Scaling.
    Package applicationautoscaling provides the client and types for making API requests to Application Auto Scaling.
    applicationautoscalingiface
    Package applicationautoscalingiface provides an interface to enable mocking the Application Auto Scaling service client for testing your code.
    Package applicationautoscalingiface provides an interface to enable mocking the Application Auto Scaling service client for testing your code.
    Package applicationdiscoveryservice provides the client and types for making API requests to AWS Application Discovery Service.
    Package applicationdiscoveryservice provides the client and types for making API requests to AWS Application Discovery Service.
    applicationdiscoveryserviceiface
    Package applicationdiscoveryserviceiface provides an interface to enable mocking the AWS Application Discovery Service service client for testing your code.
    Package applicationdiscoveryserviceiface provides an interface to enable mocking the AWS Application Discovery Service service client for testing your code.
    Package appstream provides the client and types for making API requests to Amazon AppStream.
    Package appstream provides the client and types for making API requests to Amazon AppStream.
    appstreamiface
    Package appstreamiface provides an interface to enable mocking the Amazon AppStream service client for testing your code.
    Package appstreamiface provides an interface to enable mocking the Amazon AppStream service client for testing your code.
    Package athena provides the client and types for making API requests to Amazon Athena.
    Package athena provides the client and types for making API requests to Amazon Athena.
    athenaiface
    Package athenaiface provides an interface to enable mocking the Amazon Athena service client for testing your code.
    Package athenaiface provides an interface to enable mocking the Amazon Athena service client for testing your code.
    Package autoscaling provides the client and types for making API requests to Auto Scaling.
    Package autoscaling provides the client and types for making API requests to Auto Scaling.
    autoscalingiface
    Package autoscalingiface provides an interface to enable mocking the Auto Scaling service client for testing your code.
    Package autoscalingiface provides an interface to enable mocking the Auto Scaling service client for testing your code.
    Package batch provides the client and types for making API requests to AWS Batch.
    Package batch provides the client and types for making API requests to AWS Batch.
    batchiface
    Package batchiface provides an interface to enable mocking the AWS Batch service client for testing your code.
    Package batchiface provides an interface to enable mocking the AWS Batch service client for testing your code.
    Package budgets provides the client and types for making API requests to AWS Budgets.
    Package budgets provides the client and types for making API requests to AWS Budgets.
    budgetsiface
    Package budgetsiface provides an interface to enable mocking the AWS Budgets service client for testing your code.
    Package budgetsiface provides an interface to enable mocking the AWS Budgets service client for testing your code.
    Package clouddirectory provides the client and types for making API requests to Amazon CloudDirectory.
    Package clouddirectory provides the client and types for making API requests to Amazon CloudDirectory.
    clouddirectoryiface
    Package clouddirectoryiface provides an interface to enable mocking the Amazon CloudDirectory service client for testing your code.
    Package clouddirectoryiface provides an interface to enable mocking the Amazon CloudDirectory service client for testing your code.
    Package cloudformation provides the client and types for making API requests to AWS CloudFormation.
    Package cloudformation provides the client and types for making API requests to AWS CloudFormation.
    cloudformationiface
    Package cloudformationiface provides an interface to enable mocking the AWS CloudFormation service client for testing your code.
    Package cloudformationiface provides an interface to enable mocking the AWS CloudFormation service client for testing your code.
    Package cloudfront provides the client and types for making API requests to Amazon CloudFront.
    Package cloudfront provides the client and types for making API requests to Amazon CloudFront.
    cloudfrontiface
    Package cloudfrontiface provides an interface to enable mocking the Amazon CloudFront service client for testing your code.
    Package cloudfrontiface provides an interface to enable mocking the Amazon CloudFront service client for testing your code.
    sign
    Package sign provides utilities to generate signed URLs for Amazon CloudFront.
    Package sign provides utilities to generate signed URLs for Amazon CloudFront.
    Package cloudhsm provides the client and types for making API requests to Amazon CloudHSM.
    Package cloudhsm provides the client and types for making API requests to Amazon CloudHSM.
    cloudhsmiface
    Package cloudhsmiface provides an interface to enable mocking the Amazon CloudHSM service client for testing your code.
    Package cloudhsmiface provides an interface to enable mocking the Amazon CloudHSM service client for testing your code.
    Package cloudsearch provides the client and types for making API requests to Amazon CloudSearch.
    Package cloudsearch provides the client and types for making API requests to Amazon CloudSearch.
    cloudsearchiface
    Package cloudsearchiface provides an interface to enable mocking the Amazon CloudSearch service client for testing your code.
    Package cloudsearchiface provides an interface to enable mocking the Amazon CloudSearch service client for testing your code.
    Package cloudsearchdomain provides the client and types for making API requests to Amazon CloudSearch Domain.
    Package cloudsearchdomain provides the client and types for making API requests to Amazon CloudSearch Domain.
    cloudsearchdomainiface
    Package cloudsearchdomainiface provides an interface to enable mocking the Amazon CloudSearch Domain service client for testing your code.
    Package cloudsearchdomainiface provides an interface to enable mocking the Amazon CloudSearch Domain service client for testing your code.
    Package cloudtrail provides the client and types for making API requests to AWS CloudTrail.
    Package cloudtrail provides the client and types for making API requests to AWS CloudTrail.
    cloudtrailiface
    Package cloudtrailiface provides an interface to enable mocking the AWS CloudTrail service client for testing your code.
    Package cloudtrailiface provides an interface to enable mocking the AWS CloudTrail service client for testing your code.
    Package cloudwatch provides the client and types for making API requests to Amazon CloudWatch.
    Package cloudwatch provides the client and types for making API requests to Amazon CloudWatch.
    cloudwatchiface
    Package cloudwatchiface provides an interface to enable mocking the Amazon CloudWatch service client for testing your code.
    Package cloudwatchiface provides an interface to enable mocking the Amazon CloudWatch service client for testing your code.
    Package cloudwatchevents provides the client and types for making API requests to Amazon CloudWatch Events.
    Package cloudwatchevents provides the client and types for making API requests to Amazon CloudWatch Events.
    cloudwatcheventsiface
    Package cloudwatcheventsiface provides an interface to enable mocking the Amazon CloudWatch Events service client for testing your code.
    Package cloudwatcheventsiface provides an interface to enable mocking the Amazon CloudWatch Events service client for testing your code.
    Package cloudwatchlogs provides the client and types for making API requests to Amazon CloudWatch Logs.
    Package cloudwatchlogs provides the client and types for making API requests to Amazon CloudWatch Logs.
    cloudwatchlogsiface
    Package cloudwatchlogsiface provides an interface to enable mocking the Amazon CloudWatch Logs service client for testing your code.
    Package cloudwatchlogsiface provides an interface to enable mocking the Amazon CloudWatch Logs service client for testing your code.
    Package codebuild provides the client and types for making API requests to AWS CodeBuild.
    Package codebuild provides the client and types for making API requests to AWS CodeBuild.
    codebuildiface
    Package codebuildiface provides an interface to enable mocking the AWS CodeBuild service client for testing your code.
    Package codebuildiface provides an interface to enable mocking the AWS CodeBuild service client for testing your code.
    Package codecommit provides the client and types for making API requests to AWS CodeCommit.
    Package codecommit provides the client and types for making API requests to AWS CodeCommit.
    codecommitiface
    Package codecommitiface provides an interface to enable mocking the AWS CodeCommit service client for testing your code.
    Package codecommitiface provides an interface to enable mocking the AWS CodeCommit service client for testing your code.
    Package codedeploy provides the client and types for making API requests to AWS CodeDeploy.
    Package codedeploy provides the client and types for making API requests to AWS CodeDeploy.
    codedeployiface
    Package codedeployiface provides an interface to enable mocking the AWS CodeDeploy service client for testing your code.
    Package codedeployiface provides an interface to enable mocking the AWS CodeDeploy service client for testing your code.
    Package codepipeline provides the client and types for making API requests to AWS CodePipeline.
    Package codepipeline provides the client and types for making API requests to AWS CodePipeline.
    codepipelineiface
    Package codepipelineiface provides an interface to enable mocking the AWS CodePipeline service client for testing your code.
    Package codepipelineiface provides an interface to enable mocking the AWS CodePipeline service client for testing your code.
    Package codestar provides the client and types for making API requests to AWS CodeStar.
    Package codestar provides the client and types for making API requests to AWS CodeStar.
    codestariface
    Package codestariface provides an interface to enable mocking the AWS CodeStar service client for testing your code.
    Package codestariface provides an interface to enable mocking the AWS CodeStar service client for testing your code.
    Package cognitoidentity provides the client and types for making API requests to Amazon Cognito Identity.
    Package cognitoidentity provides the client and types for making API requests to Amazon Cognito Identity.
    cognitoidentityiface
    Package cognitoidentityiface provides an interface to enable mocking the Amazon Cognito Identity service client for testing your code.
    Package cognitoidentityiface provides an interface to enable mocking the Amazon Cognito Identity service client for testing your code.
    Package cognitoidentityprovider provides the client and types for making API requests to Amazon Cognito Identity Provider.
    Package cognitoidentityprovider provides the client and types for making API requests to Amazon Cognito Identity Provider.
    cognitoidentityprovideriface
    Package cognitoidentityprovideriface provides an interface to enable mocking the Amazon Cognito Identity Provider service client for testing your code.
    Package cognitoidentityprovideriface provides an interface to enable mocking the Amazon Cognito Identity Provider service client for testing your code.
    Package cognitosync provides the client and types for making API requests to Amazon Cognito Sync.
    Package cognitosync provides the client and types for making API requests to Amazon Cognito Sync.
    cognitosynciface
    Package cognitosynciface provides an interface to enable mocking the Amazon Cognito Sync service client for testing your code.
    Package cognitosynciface provides an interface to enable mocking the Amazon Cognito Sync service client for testing your code.
    Package configservice provides the client and types for making API requests to AWS Config.
    Package configservice provides the client and types for making API requests to AWS Config.
    configserviceiface
    Package configserviceiface provides an interface to enable mocking the AWS Config service client for testing your code.
    Package configserviceiface provides an interface to enable mocking the AWS Config service client for testing your code.
    Package costandusagereportservice provides the client and types for making API requests to AWS Cost and Usage Report Service.
    Package costandusagereportservice provides the client and types for making API requests to AWS Cost and Usage Report Service.
    costandusagereportserviceiface
    Package costandusagereportserviceiface provides an interface to enable mocking the AWS Cost and Usage Report Service service client for testing your code.
    Package costandusagereportserviceiface provides an interface to enable mocking the AWS Cost and Usage Report Service service client for testing your code.
    Package databasemigrationservice provides the client and types for making API requests to AWS Database Migration Service.
    Package databasemigrationservice provides the client and types for making API requests to AWS Database Migration Service.
    databasemigrationserviceiface
    Package databasemigrationserviceiface provides an interface to enable mocking the AWS Database Migration Service service client for testing your code.
    Package databasemigrationserviceiface provides an interface to enable mocking the AWS Database Migration Service service client for testing your code.
    Package datapipeline provides the client and types for making API requests to AWS Data Pipeline.
    Package datapipeline provides the client and types for making API requests to AWS Data Pipeline.
    datapipelineiface
    Package datapipelineiface provides an interface to enable mocking the AWS Data Pipeline service client for testing your code.
    Package datapipelineiface provides an interface to enable mocking the AWS Data Pipeline service client for testing your code.
    dax
    Package dax provides the client and types for making API requests to Amazon DynamoDB Accelerator (DAX).
    Package dax provides the client and types for making API requests to Amazon DynamoDB Accelerator (DAX).
    daxiface
    Package daxiface provides an interface to enable mocking the Amazon DynamoDB Accelerator (DAX) service client for testing your code.
    Package daxiface provides an interface to enable mocking the Amazon DynamoDB Accelerator (DAX) service client for testing your code.
    Package devicefarm provides the client and types for making API requests to AWS Device Farm.
    Package devicefarm provides the client and types for making API requests to AWS Device Farm.
    devicefarmiface
    Package devicefarmiface provides an interface to enable mocking the AWS Device Farm service client for testing your code.
    Package devicefarmiface provides an interface to enable mocking the AWS Device Farm service client for testing your code.
    Package directconnect provides the client and types for making API requests to AWS Direct Connect.
    Package directconnect provides the client and types for making API requests to AWS Direct Connect.
    directconnectiface
    Package directconnectiface provides an interface to enable mocking the AWS Direct Connect service client for testing your code.
    Package directconnectiface provides an interface to enable mocking the AWS Direct Connect service client for testing your code.
    Package directoryservice provides the client and types for making API requests to AWS Directory Service.
    Package directoryservice provides the client and types for making API requests to AWS Directory Service.
    directoryserviceiface
    Package directoryserviceiface provides an interface to enable mocking the AWS Directory Service service client for testing your code.
    Package directoryserviceiface provides an interface to enable mocking the AWS Directory Service service client for testing your code.
    Package dynamodb provides the client and types for making API requests to Amazon DynamoDB.
    Package dynamodb provides the client and types for making API requests to Amazon DynamoDB.
    dynamodbattribute
    Package dynamodbattribute provides marshaling and unmarshaling utilities to convert between Go types and dynamodb.AttributeValues.
    Package dynamodbattribute provides marshaling and unmarshaling utilities to convert between Go types and dynamodb.AttributeValues.
    dynamodbiface
    Package dynamodbiface provides an interface to enable mocking the Amazon DynamoDB service client for testing your code.
    Package dynamodbiface provides an interface to enable mocking the Amazon DynamoDB service client for testing your code.
    Package dynamodbstreams provides the client and types for making API requests to Amazon DynamoDB Streams.
    Package dynamodbstreams provides the client and types for making API requests to Amazon DynamoDB Streams.
    dynamodbstreamsiface
    Package dynamodbstreamsiface provides an interface to enable mocking the Amazon DynamoDB Streams service client for testing your code.
    Package dynamodbstreamsiface provides an interface to enable mocking the Amazon DynamoDB Streams service client for testing your code.
    ec2
    Package ec2 provides the client and types for making API requests to Amazon Elastic Compute Cloud.
    Package ec2 provides the client and types for making API requests to Amazon Elastic Compute Cloud.
    ec2iface
    Package ec2iface provides an interface to enable mocking the Amazon Elastic Compute Cloud service client for testing your code.
    Package ec2iface provides an interface to enable mocking the Amazon Elastic Compute Cloud service client for testing your code.
    ecr
    Package ecr provides the client and types for making API requests to Amazon EC2 Container Registry.
    Package ecr provides the client and types for making API requests to Amazon EC2 Container Registry.
    ecriface
    Package ecriface provides an interface to enable mocking the Amazon EC2 Container Registry service client for testing your code.
    Package ecriface provides an interface to enable mocking the Amazon EC2 Container Registry service client for testing your code.
    ecs
    Package ecs provides the client and types for making API requests to Amazon EC2 Container Service.
    Package ecs provides the client and types for making API requests to Amazon EC2 Container Service.
    ecsiface
    Package ecsiface provides an interface to enable mocking the Amazon EC2 Container Service service client for testing your code.
    Package ecsiface provides an interface to enable mocking the Amazon EC2 Container Service service client for testing your code.
    efs
    Package efs provides the client and types for making API requests to Amazon Elastic File System.
    Package efs provides the client and types for making API requests to Amazon Elastic File System.
    efsiface
    Package efsiface provides an interface to enable mocking the Amazon Elastic File System service client for testing your code.
    Package efsiface provides an interface to enable mocking the Amazon Elastic File System service client for testing your code.
    Package elasticache provides the client and types for making API requests to Amazon ElastiCache.
    Package elasticache provides the client and types for making API requests to Amazon ElastiCache.
    elasticacheiface
    Package elasticacheiface provides an interface to enable mocking the Amazon ElastiCache service client for testing your code.
    Package elasticacheiface provides an interface to enable mocking the Amazon ElastiCache service client for testing your code.
    Package elasticbeanstalk provides the client and types for making API requests to AWS Elastic Beanstalk.
    Package elasticbeanstalk provides the client and types for making API requests to AWS Elastic Beanstalk.
    elasticbeanstalkiface
    Package elasticbeanstalkiface provides an interface to enable mocking the AWS Elastic Beanstalk service client for testing your code.
    Package elasticbeanstalkiface provides an interface to enable mocking the AWS Elastic Beanstalk service client for testing your code.
    Package elasticsearchservice provides the client and types for making API requests to Amazon Elasticsearch Service.
    Package elasticsearchservice provides the client and types for making API requests to Amazon Elasticsearch Service.
    elasticsearchserviceiface
    Package elasticsearchserviceiface provides an interface to enable mocking the Amazon Elasticsearch Service service client for testing your code.
    Package elasticsearchserviceiface provides an interface to enable mocking the Amazon Elasticsearch Service service client for testing your code.
    Package elastictranscoder provides the client and types for making API requests to Amazon Elastic Transcoder.
    Package elastictranscoder provides the client and types for making API requests to Amazon Elastic Transcoder.
    elastictranscoderiface
    Package elastictranscoderiface provides an interface to enable mocking the Amazon Elastic Transcoder service client for testing your code.
    Package elastictranscoderiface provides an interface to enable mocking the Amazon Elastic Transcoder service client for testing your code.
    elb
    Package elb provides the client and types for making API requests to Elastic Load Balancing.
    Package elb provides the client and types for making API requests to Elastic Load Balancing.
    elbiface
    Package elbiface provides an interface to enable mocking the Elastic Load Balancing service client for testing your code.
    Package elbiface provides an interface to enable mocking the Elastic Load Balancing service client for testing your code.
    Package elbv2 provides the client and types for making API requests to Elastic Load Balancing.
    Package elbv2 provides the client and types for making API requests to Elastic Load Balancing.
    elbv2iface
    Package elbv2iface provides an interface to enable mocking the Elastic Load Balancing service client for testing your code.
    Package elbv2iface provides an interface to enable mocking the Elastic Load Balancing service client for testing your code.
    emr
    Package emr provides the client and types for making API requests to Amazon Elastic MapReduce.
    Package emr provides the client and types for making API requests to Amazon Elastic MapReduce.
    emriface
    Package emriface provides an interface to enable mocking the Amazon Elastic MapReduce service client for testing your code.
    Package emriface provides an interface to enable mocking the Amazon Elastic MapReduce service client for testing your code.
    Package firehose provides the client and types for making API requests to Amazon Kinesis Firehose.
    Package firehose provides the client and types for making API requests to Amazon Kinesis Firehose.
    firehoseiface
    Package firehoseiface provides an interface to enable mocking the Amazon Kinesis Firehose service client for testing your code.
    Package firehoseiface provides an interface to enable mocking the Amazon Kinesis Firehose service client for testing your code.
    Package gamelift provides the client and types for making API requests to Amazon GameLift.
    Package gamelift provides the client and types for making API requests to Amazon GameLift.
    gameliftiface
    Package gameliftiface provides an interface to enable mocking the Amazon GameLift service client for testing your code.
    Package gameliftiface provides an interface to enable mocking the Amazon GameLift service client for testing your code.
    Package glacier provides the client and types for making API requests to Amazon Glacier.
    Package glacier provides the client and types for making API requests to Amazon Glacier.
    glacieriface
    Package glacieriface provides an interface to enable mocking the Amazon Glacier service client for testing your code.
    Package glacieriface provides an interface to enable mocking the Amazon Glacier service client for testing your code.
    Package greengrass provides the client and types for making API requests to AWS Greengrass.
    Package greengrass provides the client and types for making API requests to AWS Greengrass.
    greengrassiface
    Package greengrassiface provides an interface to enable mocking the AWS Greengrass service client for testing your code.
    Package greengrassiface provides an interface to enable mocking the AWS Greengrass service client for testing your code.
    Package health provides the client and types for making API requests to AWS Health APIs and Notifications.
    Package health provides the client and types for making API requests to AWS Health APIs and Notifications.
    healthiface
    Package healthiface provides an interface to enable mocking the AWS Health APIs and Notifications service client for testing your code.
    Package healthiface provides an interface to enable mocking the AWS Health APIs and Notifications service client for testing your code.
    iam
    Package iam provides the client and types for making API requests to AWS Identity and Access Management.
    Package iam provides the client and types for making API requests to AWS Identity and Access Management.
    iamiface
    Package iamiface provides an interface to enable mocking the AWS Identity and Access Management service client for testing your code.
    Package iamiface provides an interface to enable mocking the AWS Identity and Access Management service client for testing your code.
    Package inspector provides the client and types for making API requests to Amazon Inspector.
    Package inspector provides the client and types for making API requests to Amazon Inspector.
    inspectoriface
    Package inspectoriface provides an interface to enable mocking the Amazon Inspector service client for testing your code.
    Package inspectoriface provides an interface to enable mocking the Amazon Inspector service client for testing your code.
    iot
    Package iot provides the client and types for making API requests to AWS IoT. AWS IoT provides secure, bi-directional communication between Internet-connected things (such as sensors, actuators, embedded devices, or smart appliances) and the AWS cloud.
    Package iot provides the client and types for making API requests to AWS IoT. AWS IoT provides secure, bi-directional communication between Internet-connected things (such as sensors, actuators, embedded devices, or smart appliances) and the AWS cloud.
    iotiface
    Package iotiface provides an interface to enable mocking the AWS IoT service client for testing your code.
    Package iotiface provides an interface to enable mocking the AWS IoT service client for testing your code.
    Package iotdataplane provides the client and types for making API requests to AWS IoT Data Plane.
    Package iotdataplane provides the client and types for making API requests to AWS IoT Data Plane.
    iotdataplaneiface
    Package iotdataplaneiface provides an interface to enable mocking the AWS IoT Data Plane service client for testing your code.
    Package iotdataplaneiface provides an interface to enable mocking the AWS IoT Data Plane service client for testing your code.
    Package kinesis provides the client and types for making API requests to Amazon Kinesis.
    Package kinesis provides the client and types for making API requests to Amazon Kinesis.
    kinesisiface
    Package kinesisiface provides an interface to enable mocking the Amazon Kinesis service client for testing your code.
    Package kinesisiface provides an interface to enable mocking the Amazon Kinesis service client for testing your code.
    Package kinesisanalytics provides the client and types for making API requests to Amazon Kinesis Analytics.
    Package kinesisanalytics provides the client and types for making API requests to Amazon Kinesis Analytics.
    kinesisanalyticsiface
    Package kinesisanalyticsiface provides an interface to enable mocking the Amazon Kinesis Analytics service client for testing your code.
    Package kinesisanalyticsiface provides an interface to enable mocking the Amazon Kinesis Analytics service client for testing your code.
    kms
    Package kms provides the client and types for making API requests to AWS Key Management Service.
    Package kms provides the client and types for making API requests to AWS Key Management Service.
    kmsiface
    Package kmsiface provides an interface to enable mocking the AWS Key Management Service service client for testing your code.
    Package kmsiface provides an interface to enable mocking the AWS Key Management Service service client for testing your code.
    Package lambda provides the client and types for making API requests to AWS Lambda.
    Package lambda provides the client and types for making API requests to AWS Lambda.
    lambdaiface
    Package lambdaiface provides an interface to enable mocking the AWS Lambda service client for testing your code.
    Package lambdaiface provides an interface to enable mocking the AWS Lambda service client for testing your code.
    Package lexmodelbuildingservice provides the client and types for making API requests to Amazon Lex Model Building Service.
    Package lexmodelbuildingservice provides the client and types for making API requests to Amazon Lex Model Building Service.
    lexmodelbuildingserviceiface
    Package lexmodelbuildingserviceiface provides an interface to enable mocking the Amazon Lex Model Building Service service client for testing your code.
    Package lexmodelbuildingserviceiface provides an interface to enable mocking the Amazon Lex Model Building Service service client for testing your code.
    Package lexruntimeservice provides the client and types for making API requests to Amazon Lex Runtime Service.
    Package lexruntimeservice provides the client and types for making API requests to Amazon Lex Runtime Service.
    lexruntimeserviceiface
    Package lexruntimeserviceiface provides an interface to enable mocking the Amazon Lex Runtime Service service client for testing your code.
    Package lexruntimeserviceiface provides an interface to enable mocking the Amazon Lex Runtime Service service client for testing your code.
    Package lightsail provides the client and types for making API requests to Amazon Lightsail.
    Package lightsail provides the client and types for making API requests to Amazon Lightsail.
    lightsailiface
    Package lightsailiface provides an interface to enable mocking the Amazon Lightsail service client for testing your code.
    Package lightsailiface provides an interface to enable mocking the Amazon Lightsail service client for testing your code.
    Package machinelearning provides the client and types for making API requests to Amazon Machine Learning.
    Package machinelearning provides the client and types for making API requests to Amazon Machine Learning.
    machinelearningiface
    Package machinelearningiface provides an interface to enable mocking the Amazon Machine Learning service client for testing your code.
    Package machinelearningiface provides an interface to enable mocking the Amazon Machine Learning service client for testing your code.
    Package marketplacecommerceanalytics provides the client and types for making API requests to AWS Marketplace Commerce Analytics.
    Package marketplacecommerceanalytics provides the client and types for making API requests to AWS Marketplace Commerce Analytics.
    marketplacecommerceanalyticsiface
    Package marketplacecommerceanalyticsiface provides an interface to enable mocking the AWS Marketplace Commerce Analytics service client for testing your code.
    Package marketplacecommerceanalyticsiface provides an interface to enable mocking the AWS Marketplace Commerce Analytics service client for testing your code.
    Package marketplaceentitlementservice provides the client and types for making API requests to AWS Marketplace Entitlement Service.
    Package marketplaceentitlementservice provides the client and types for making API requests to AWS Marketplace Entitlement Service.
    marketplaceentitlementserviceiface
    Package marketplaceentitlementserviceiface provides an interface to enable mocking the AWS Marketplace Entitlement Service service client for testing your code.
    Package marketplaceentitlementserviceiface provides an interface to enable mocking the AWS Marketplace Entitlement Service service client for testing your code.
    Package marketplacemetering provides the client and types for making API requests to AWSMarketplace Metering.
    Package marketplacemetering provides the client and types for making API requests to AWSMarketplace Metering.
    marketplacemeteringiface
    Package marketplacemeteringiface provides an interface to enable mocking the AWSMarketplace Metering service client for testing your code.
    Package marketplacemeteringiface provides an interface to enable mocking the AWSMarketplace Metering service client for testing your code.
    Package mobileanalytics provides the client and types for making API requests to Amazon Mobile Analytics.
    Package mobileanalytics provides the client and types for making API requests to Amazon Mobile Analytics.
    mobileanalyticsiface
    Package mobileanalyticsiface provides an interface to enable mocking the Amazon Mobile Analytics service client for testing your code.
    Package mobileanalyticsiface provides an interface to enable mocking the Amazon Mobile Analytics service client for testing your code.
    Package mturk provides the client and types for making API requests to Amazon Mechanical Turk.
    Package mturk provides the client and types for making API requests to Amazon Mechanical Turk.
    mturkiface
    Package mturkiface provides an interface to enable mocking the Amazon Mechanical Turk service client for testing your code.
    Package mturkiface provides an interface to enable mocking the Amazon Mechanical Turk service client for testing your code.
    Package opsworks provides the client and types for making API requests to AWS OpsWorks.
    Package opsworks provides the client and types for making API requests to AWS OpsWorks.
    opsworksiface
    Package opsworksiface provides an interface to enable mocking the AWS OpsWorks service client for testing your code.
    Package opsworksiface provides an interface to enable mocking the AWS OpsWorks service client for testing your code.
    Package opsworkscm provides the client and types for making API requests to AWS OpsWorks for Chef Automate.
    Package opsworkscm provides the client and types for making API requests to AWS OpsWorks for Chef Automate.
    opsworkscmiface
    Package opsworkscmiface provides an interface to enable mocking the AWS OpsWorks for Chef Automate service client for testing your code.
    Package opsworkscmiface provides an interface to enable mocking the AWS OpsWorks for Chef Automate service client for testing your code.
    Package organizations provides the client and types for making API requests to AWS Organizations.
    Package organizations provides the client and types for making API requests to AWS Organizations.
    organizationsiface
    Package organizationsiface provides an interface to enable mocking the AWS Organizations service client for testing your code.
    Package organizationsiface provides an interface to enable mocking the AWS Organizations service client for testing your code.
    Package pinpoint provides the client and types for making API requests to Amazon Pinpoint.
    Package pinpoint provides the client and types for making API requests to Amazon Pinpoint.
    pinpointiface
    Package pinpointiface provides an interface to enable mocking the Amazon Pinpoint service client for testing your code.
    Package pinpointiface provides an interface to enable mocking the Amazon Pinpoint service client for testing your code.
    Package polly provides the client and types for making API requests to Amazon Polly.
    Package polly provides the client and types for making API requests to Amazon Polly.
    pollyiface
    Package pollyiface provides an interface to enable mocking the Amazon Polly service client for testing your code.
    Package pollyiface provides an interface to enable mocking the Amazon Polly service client for testing your code.
    rds
    Package rds provides the client and types for making API requests to Amazon Relational Database Service.
    Package rds provides the client and types for making API requests to Amazon Relational Database Service.
    rdsiface
    Package rdsiface provides an interface to enable mocking the Amazon Relational Database Service service client for testing your code.
    Package rdsiface provides an interface to enable mocking the Amazon Relational Database Service service client for testing your code.
    Package redshift provides the client and types for making API requests to Amazon Redshift.
    Package redshift provides the client and types for making API requests to Amazon Redshift.
    redshiftiface
    Package redshiftiface provides an interface to enable mocking the Amazon Redshift service client for testing your code.
    Package redshiftiface provides an interface to enable mocking the Amazon Redshift service client for testing your code.
    Package rekognition provides the client and types for making API requests to Amazon Rekognition.
    Package rekognition provides the client and types for making API requests to Amazon Rekognition.
    rekognitioniface
    Package rekognitioniface provides an interface to enable mocking the Amazon Rekognition service client for testing your code.
    Package rekognitioniface provides an interface to enable mocking the Amazon Rekognition service client for testing your code.
    Package resourcegroupstaggingapi provides the client and types for making API requests to AWS Resource Groups Tagging API.
    Package resourcegroupstaggingapi provides the client and types for making API requests to AWS Resource Groups Tagging API.
    resourcegroupstaggingapiiface
    Package resourcegroupstaggingapiiface provides an interface to enable mocking the AWS Resource Groups Tagging API service client for testing your code.
    Package resourcegroupstaggingapiiface provides an interface to enable mocking the AWS Resource Groups Tagging API service client for testing your code.
    Package route53 provides the client and types for making API requests to Amazon Route 53.
    Package route53 provides the client and types for making API requests to Amazon Route 53.
    route53iface
    Package route53iface provides an interface to enable mocking the Amazon Route 53 service client for testing your code.
    Package route53iface provides an interface to enable mocking the Amazon Route 53 service client for testing your code.
    Package route53domains provides the client and types for making API requests to Amazon Route 53 Domains.
    Package route53domains provides the client and types for making API requests to Amazon Route 53 Domains.
    route53domainsiface
    Package route53domainsiface provides an interface to enable mocking the Amazon Route 53 Domains service client for testing your code.
    Package route53domainsiface provides an interface to enable mocking the Amazon Route 53 Domains service client for testing your code.
    s3
    Package s3 provides the client and types for making API requests to Amazon Simple Storage Service.
    Package s3 provides the client and types for making API requests to Amazon Simple Storage Service.
    s3crypto
    Package s3crypto provides encryption to S3 using KMS and AES GCM.
    Package s3crypto provides encryption to S3 using KMS and AES GCM.
    s3iface
    Package s3iface provides an interface to enable mocking the Amazon Simple Storage Service service client for testing your code.
    Package s3iface provides an interface to enable mocking the Amazon Simple Storage Service service client for testing your code.
    s3manager
    Package s3manager provides utilities to upload and download objects from S3 concurrently.
    Package s3manager provides utilities to upload and download objects from S3 concurrently.
    s3manager/s3manageriface
    Package s3manageriface provides an interface for the s3manager package
    Package s3manageriface provides an interface for the s3manager package
    Package servicecatalog provides the client and types for making API requests to AWS Service Catalog.
    Package servicecatalog provides the client and types for making API requests to AWS Service Catalog.
    servicecatalogiface
    Package servicecatalogiface provides an interface to enable mocking the AWS Service Catalog service client for testing your code.
    Package servicecatalogiface provides an interface to enable mocking the AWS Service Catalog service client for testing your code.
    ses
    Package ses provides the client and types for making API requests to Amazon Simple Email Service.
    Package ses provides the client and types for making API requests to Amazon Simple Email Service.
    sesiface
    Package sesiface provides an interface to enable mocking the Amazon Simple Email Service service client for testing your code.
    Package sesiface provides an interface to enable mocking the Amazon Simple Email Service service client for testing your code.
    sfn
    Package sfn provides the client and types for making API requests to AWS Step Functions.
    Package sfn provides the client and types for making API requests to AWS Step Functions.
    sfniface
    Package sfniface provides an interface to enable mocking the AWS Step Functions service client for testing your code.
    Package sfniface provides an interface to enable mocking the AWS Step Functions service client for testing your code.
    Package shield provides the client and types for making API requests to AWS Shield.
    Package shield provides the client and types for making API requests to AWS Shield.
    shieldiface
    Package shieldiface provides an interface to enable mocking the AWS Shield service client for testing your code.
    Package shieldiface provides an interface to enable mocking the AWS Shield service client for testing your code.
    Package simpledb provides the client and types for making API requests to Amazon SimpleDB.
    Package simpledb provides the client and types for making API requests to Amazon SimpleDB.
    simpledbiface
    Package simpledbiface provides an interface to enable mocking the Amazon SimpleDB service client for testing your code.
    Package simpledbiface provides an interface to enable mocking the Amazon SimpleDB service client for testing your code.
    sms
    Package sms provides the client and types for making API requests to AWS Server Migration Service.
    Package sms provides the client and types for making API requests to AWS Server Migration Service.
    smsiface
    Package smsiface provides an interface to enable mocking the AWS Server Migration Service service client for testing your code.
    Package smsiface provides an interface to enable mocking the AWS Server Migration Service service client for testing your code.
    Package snowball provides the client and types for making API requests to Amazon Import/Export Snowball.
    Package snowball provides the client and types for making API requests to Amazon Import/Export Snowball.
    snowballiface
    Package snowballiface provides an interface to enable mocking the Amazon Import/Export Snowball service client for testing your code.
    Package snowballiface provides an interface to enable mocking the Amazon Import/Export Snowball service client for testing your code.
    sns
    Package sns provides the client and types for making API requests to Amazon Simple Notification Service.
    Package sns provides the client and types for making API requests to Amazon Simple Notification Service.
    snsiface
    Package snsiface provides an interface to enable mocking the Amazon Simple Notification Service service client for testing your code.
    Package snsiface provides an interface to enable mocking the Amazon Simple Notification Service service client for testing your code.
    sqs
    Package sqs provides the client and types for making API requests to Amazon Simple Queue Service.
    Package sqs provides the client and types for making API requests to Amazon Simple Queue Service.
    sqsiface
    Package sqsiface provides an interface to enable mocking the Amazon Simple Queue Service service client for testing your code.
    Package sqsiface provides an interface to enable mocking the Amazon Simple Queue Service service client for testing your code.
    ssm
    Package ssm provides the client and types for making API requests to Amazon Simple Systems Manager (SSM).
    Package ssm provides the client and types for making API requests to Amazon Simple Systems Manager (SSM).
    ssmiface
    Package ssmiface provides an interface to enable mocking the Amazon Simple Systems Manager (SSM) service client for testing your code.
    Package ssmiface provides an interface to enable mocking the Amazon Simple Systems Manager (SSM) service client for testing your code.
    Package storagegateway provides the client and types for making API requests to AWS Storage Gateway.
    Package storagegateway provides the client and types for making API requests to AWS Storage Gateway.
    storagegatewayiface
    Package storagegatewayiface provides an interface to enable mocking the AWS Storage Gateway service client for testing your code.
    Package storagegatewayiface provides an interface to enable mocking the AWS Storage Gateway service client for testing your code.
    sts
    Package sts provides the client and types for making API requests to AWS Security Token Service.
    Package sts provides the client and types for making API requests to AWS Security Token Service.
    stsiface
    Package stsiface provides an interface to enable mocking the AWS Security Token Service service client for testing your code.
    Package stsiface provides an interface to enable mocking the AWS Security Token Service service client for testing your code.
    Package support provides the client and types for making API requests to AWS Support.
    Package support provides the client and types for making API requests to AWS Support.
    supportiface
    Package supportiface provides an interface to enable mocking the AWS Support service client for testing your code.
    Package supportiface provides an interface to enable mocking the AWS Support service client for testing your code.
    swf
    Package swf provides the client and types for making API requests to Amazon Simple Workflow Service.
    Package swf provides the client and types for making API requests to Amazon Simple Workflow Service.
    swfiface
    Package swfiface provides an interface to enable mocking the Amazon Simple Workflow Service service client for testing your code.
    Package swfiface provides an interface to enable mocking the Amazon Simple Workflow Service service client for testing your code.
    waf
    Package waf provides the client and types for making API requests to AWS WAF.
    Package waf provides the client and types for making API requests to AWS WAF.
    wafiface
    Package wafiface provides an interface to enable mocking the AWS WAF service client for testing your code.
    Package wafiface provides an interface to enable mocking the AWS WAF service client for testing your code.
    Package wafregional provides the client and types for making API requests to AWS WAF Regional.
    Package wafregional provides the client and types for making API requests to AWS WAF Regional.
    wafregionaliface
    Package wafregionaliface provides an interface to enable mocking the AWS WAF Regional service client for testing your code.
    Package wafregionaliface provides an interface to enable mocking the AWS WAF Regional service client for testing your code.
    Package workdocs provides the client and types for making API requests to Amazon WorkDocs.
    Package workdocs provides the client and types for making API requests to Amazon WorkDocs.
    workdocsiface
    Package workdocsiface provides an interface to enable mocking the Amazon WorkDocs service client for testing your code.
    Package workdocsiface provides an interface to enable mocking the Amazon WorkDocs service client for testing your code.
    Package workspaces provides the client and types for making API requests to Amazon WorkSpaces.
    Package workspaces provides the client and types for making API requests to Amazon WorkSpaces.
    workspacesiface
    Package workspacesiface provides an interface to enable mocking the Amazon WorkSpaces service client for testing your code.
    Package workspacesiface provides an interface to enable mocking the Amazon WorkSpaces service client for testing your code.
    Package xray provides the client and types for making API requests to AWS X-Ray.
    Package xray provides the client and types for making API requests to AWS X-Ray.
    xrayiface
    Package xrayiface provides an interface to enable mocking the AWS X-Ray service client for testing your code.
    Package xrayiface provides an interface to enable mocking the AWS X-Ray service client for testing your code.